Comparing GFF81 FitnessBrowser__Phaeo:GFF81 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
P97084 Threonine-phosphate decarboxylase; L-threonine-O-3-phosphate decarboxylase; EC 4.1.1.81 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
27% identity, 86% coverage: 51:356/356 of query aligns to 8:353/364 of P97084
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
27% identity, 86% coverage: 51:356/356 of query aligns to 1:346/355 of 1lkcA
1lc8A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with its reaction intermediate (see paper)
27% identity, 86% coverage: 51:356/356 of query aligns to 2:347/356 of 1lc8A
1lc7A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with a substrate (see paper)
27% identity, 86% coverage: 51:356/356 of query aligns to 5:350/358 of 1lc7A
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
36% identity, 27% coverage: 173:269/356 of query aligns to 136:241/335 of 1geyA
Sites not aligning to the query:
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
36% identity, 27% coverage: 173:269/356 of query aligns to 150:255/354 of 1fg7A
Sites not aligning to the query:
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
36% identity, 27% coverage: 173:269/356 of query aligns to 150:255/354 of 1fg3A
Sites not aligning to the query:
P0DV65 L-serine phosphate decarboxylase; CobD homolog SMUL_1544; SmCobD; L-serine O-phosphate decarboxylase; L-Ser-P decarboxylase; Norcobamide biosynthesis protein SMUL_1544; Threonine phosphate decarboxylase-like enzyme; EC 4.1.1.- from Sulfurospirillum multivorans (strain DM 12446 / JCM 15788 / NBRC 109480) (see paper)
32% identity, 32% coverage: 156:270/356 of query aligns to 158:283/392 of P0DV65
Sites not aligning to the query:
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
25% identity, 43% coverage: 146:297/356 of query aligns to 118:295/369 of 4wbtA
Sites not aligning to the query:
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
32% identity, 27% coverage: 173:269/356 of query aligns to 150:255/353 of 7szpA
Sites not aligning to the query:
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
29% identity, 36% coverage: 161:289/356 of query aligns to 149:283/360 of 8bj3A
Sites not aligning to the query:
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
26% identity, 46% coverage: 159:322/356 of query aligns to 153:326/366 of 3cq5B
Sites not aligning to the query:
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
26% identity, 46% coverage: 159:322/356 of query aligns to 151:324/364 of 3cq6A
Sites not aligning to the query:
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
37% identity, 24% coverage: 173:259/356 of query aligns to 152:250/353 of 4r5zA
Sites not aligning to the query:
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
37% identity, 24% coverage: 173:259/356 of query aligns to 152:250/353 of 4r2nA
Sites not aligning to the query:
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
24% identity, 46% coverage: 169:330/356 of query aligns to 163:333/369 of 4r8dA
Sites not aligning to the query:
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
23% identity, 54% coverage: 154:345/356 of query aligns to 126:334/354 of 3ly1D
Sites not aligning to the query:
>GFF81 FitnessBrowser__Phaeo:GFF81
MIPRRYGCFLAIAVPYGGIGSAYFWPSVLVHLLRPKMTGMLDLTEVPKRDHGGNLSAAIS
EFGGVASDWVDISTGINPVPYPVPDLTAADWGALPDQAAMTDLVTAARHFWNVPQEAAVL
AAPGASALIAAIPALADPRWVQITPPTYNEHAAAFAARGWQTVTAGPAEACVLVHPNNPD
GRRWSAEDVQAPLVVIDESFCDVCPADSLIHLANRPGVVILKSFGKFWGLAGLRLGFAIG
DPSLIGNLAAWQGPWAVSGPALRIGAQALRDADWAETTRARLQQDAKRLDKMVTGKGAKL
VGGTDLFRLYDVDDAAAWQARLASAQIWTRIFPYSKTYLRLGLPTGEGWERLEAAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory