SitesBLAST
Comparing GFF829 FitnessBrowser__Phaeo:GFF829 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
36% identity, 94% coverage: 7:248/257 of query aligns to 8:253/258 of 3ak4A
- active site: G18 (= G17), S141 (= S136), L151 (≠ R146), Y154 (= Y149), K158 (= K153), E199 (= E194)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ S16), G18 (= G17), I19 (= I18), D38 (= D37), L39 (≠ V38), V60 (= V55), D61 (= D56), V62 (≠ A57), N88 (= N83), A89 (= A84), G90 (= G85), T139 (= T134), S141 (= S136), Y154 (= Y149), K158 (= K153), G185 (= G180), V187 (= V182), T189 (≠ G184), M191 (≠ R186)
6zzpA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and 3-oxovalerate (see paper)
34% identity, 91% coverage: 10:244/257 of query aligns to 14:256/265 of 6zzpA
- binding nicotinamide-adenine-dinucleotide: G17 (≠ A13), S20 (= S16), G21 (= G17), I22 (= I18), D41 (= D37), I42 (≠ V38), M66 (vs. gap), D67 (= D56), V68 (≠ A57), N94 (= N83), A95 (= A84), G96 (= G85), M145 (≠ T134), S147 (= S136), Y160 (= Y149), K164 (= K153), P190 (= P179), F192 (≠ A181), V193 (= V182), T195 (≠ G184), L197 (≠ R186), V198 (≠ M187)
- binding 3-oxidanylidenepentanoic acid: Q98 (≠ A87), S147 (= S136), H149 (≠ A138), K157 (≠ R146), Y160 (= Y149), F192 (≠ A181), Q201 (≠ V190)
6zzoC Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and acetoacetate (see paper)
34% identity, 91% coverage: 10:244/257 of query aligns to 14:256/265 of 6zzoC
- binding acetoacetic acid: Q98 (≠ A87), H149 (≠ A138), K157 (≠ R146), F192 (≠ A181), Q201 (≠ V190)
- binding nicotinamide-adenine-dinucleotide: G17 (≠ A13), S20 (= S16), G21 (= G17), I22 (= I18), D41 (= D37), I42 (≠ V38), M66 (vs. gap), D67 (= D56), V68 (≠ A57), N94 (= N83), A95 (= A84), G96 (= G85), M145 (≠ T134), Y160 (= Y149), K164 (= K153), P190 (= P179), F192 (≠ A181), V193 (= V182), T195 (≠ G184), L197 (≠ R186), V198 (≠ M187)
3rwbA Crystal structure of complex of 4pal (4-pyridoxolactone) and pldh (tetrameric pyridoxal 4-dehydrogenase) from mesorhizobium loti
36% identity, 93% coverage: 10:247/257 of query aligns to 10:241/247 of 3rwbA
- active site: G17 (= G17), S140 (= S136), Y153 (= Y149), K157 (= K153)
- binding 7-hydroxy-6-methylfuro[3,4-c]pyridin-1(3H)-one: S140 (= S136), N141 (≠ T137), T142 (≠ A138), M150 (≠ R146), Y153 (= Y149), L185 (≠ A181), H196 (≠ R202)
- binding nicotinamide-adenine-dinucleotide: G13 (≠ A13), Q16 (≠ S16), G17 (= G17), I18 (= I18), D37 (= D37), I38 (≠ V38), D60 (= D56), I61 (≠ A57), N87 (= N83), A88 (= A84), S89 (≠ G85), I138 (≠ T134), S140 (= S136), Y153 (= Y149), K157 (= K153), P183 (= P179), L185 (≠ A181), I186 (≠ V182), S188 (≠ G184), G190 (= G189), V191 (= V190)
3ndrA Crystal structure of tetrameric pyridoxal 4-dehydrogenase from mesorhizobium loti
36% identity, 93% coverage: 10:247/257 of query aligns to 10:241/247 of 3ndrA
- active site: G17 (= G17), S140 (= S136), Y153 (= Y149), K157 (= K153)
- binding nicotinamide-adenine-dinucleotide: G13 (≠ A13), Q16 (≠ S16), G17 (= G17), I18 (= I18), D37 (= D37), I38 (≠ V38), D60 (= D56), I61 (≠ A57), N87 (= N83), A88 (= A84), S89 (≠ G85), V110 (= V107), I138 (≠ T134), S140 (= S136), Y153 (= Y149), K157 (= K153), P183 (= P179), L185 (≠ A181), I186 (≠ V182), S188 (≠ G184), G190 (= G189), V191 (= V190)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
35% identity, 93% coverage: 9:248/257 of query aligns to 16:261/267 of Q9LBG2
- 17:42 (vs. 10:35, 54% identical) binding
- E103 (≠ A87) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
1iy8A Crystal structure of levodione reductase (see paper)
35% identity, 93% coverage: 9:248/257 of query aligns to 7:252/258 of 1iy8A
- active site: G15 (= G17), S143 (= S136), Q153 (≠ R146), Y156 (= Y149), K160 (= K153)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A13), S14 (= S16), G15 (= G17), L16 (≠ I18), D35 (= D37), V36 (= V38), A62 (≠ V55), D63 (= D56), V64 (≠ A57), N90 (= N83), G92 (= G85), I93 (= I86), T141 (= T134), S143 (= S136), Y156 (= Y149), K160 (= K153), P186 (= P179), G187 (= G180), T191 (≠ G184), P192 (= P185), M193 (≠ R186)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
35% identity, 93% coverage: 9:248/257 of query aligns to 10:250/255 of 5itvA
- active site: G18 (= G17), S141 (= S136), Y154 (= Y149), K158 (= K153)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (≠ A13), S17 (= S16), G18 (= G17), I19 (= I18), D38 (= D37), I39 (≠ V38), T61 (vs. gap), I63 (≠ A57), N89 (= N83), G91 (= G85), T139 (= T134), S141 (= S136), Y154 (= Y149), K158 (= K153), P184 (= P179), G185 (= G180), I186 (≠ A181), I187 (≠ V182)
6zyzA Structure of the borneol dehydrogenases of salvia rosmarinus with NAD+ (see paper)
35% identity, 93% coverage: 10:248/257 of query aligns to 9:244/259 of 6zyzA
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A13), S15 (= S16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (≠ V38), Q38 (≠ S39), C58 (≠ V55), D59 (= D56), V60 (≠ A57), N86 (= N83), A87 (= A84), V90 (≠ A87), I110 (≠ V107), T137 (= T134), Y152 (= Y149), K156 (= K153), V185 (= V182)
- binding (2S)-1-[3-{[(2R)-2-hydroxypropyl]oxy}-2,2-bis({[(2R)-2-hydroxypropyl]oxy}methyl)propoxy]propan-2-ol: P93 (= P89), N94 (≠ T90), S95 (≠ A91), D98 (= D95)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
32% identity, 93% coverage: 10:248/257 of query aligns to 9:243/248 of 6ixmC
- active site: G16 (= G17), S142 (= S136), Y155 (= Y149), K159 (= K153)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A13), S15 (= S16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (≠ V38), A61 (vs. gap), D62 (= D56), T63 (≠ A57), N89 (= N83), A90 (= A84), M140 (≠ T134), S142 (= S136), Y155 (= Y149), K159 (= K153), P185 (= P179), A186 (≠ G180), Y187 (≠ A181), I188 (≠ V182), L192 (≠ R186)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
33% identity, 93% coverage: 10:248/257 of query aligns to 10:255/260 of 6zzqA
- active site: G17 (= G17), S142 (= S136), Y155 (= Y149)
- binding acetoacetic acid: Q94 (≠ A87), S142 (= S136), K152 (≠ R146), Y155 (= Y149), Q196 (≠ V190)
- binding nicotinamide-adenine-dinucleotide: G13 (≠ A13), S16 (= S16), G17 (= G17), I18 (= I18), D37 (= D37), M38 (≠ V38), D63 (vs. gap), V64 (vs. gap), N90 (= N83), A91 (= A84), G92 (= G85), M140 (≠ T134), A141 (≠ S135), S142 (= S136), Y155 (= Y149), K159 (= K153), Y187 (≠ A181), V188 (= V182), T190 (≠ G184)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
33% identity, 93% coverage: 10:248/257 of query aligns to 11:256/261 of 6zzsD
- active site: G18 (= G17), S143 (= S136), Y156 (= Y149)
- binding nicotinamide-adenine-dinucleotide: G14 (≠ A13), S17 (= S16), I19 (= I18), D38 (= D37), M39 (≠ V38), D64 (vs. gap), V65 (vs. gap), N91 (= N83), A92 (= A84), G93 (= G85), M141 (≠ T134), A142 (≠ S135), S143 (= S136), Y156 (= Y149), K160 (= K153), P186 (= P179), G187 (= G180), V189 (= V182), T191 (≠ G184), L193 (≠ R186)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ A87), S143 (= S136), N145 (≠ A138), K153 (≠ R146), Y156 (= Y149), Q197 (≠ V190)
3toxA Crystal structure of a short chain dehydrogenase in complex with NAD(p) from sinorhizobium meliloti 1021
35% identity, 93% coverage: 10:248/257 of query aligns to 9:248/254 of 3toxA
- active site: G16 (= G17), S142 (= S136), V153 (≠ R146), Y156 (= Y149), K160 (= K153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (≠ A13), S14 (≠ G15), S15 (= S16), G16 (= G17), I17 (= I18), A36 (≠ D37), R37 (≠ V38), N38 (≠ S39), V63 (≠ A57), N89 (= N83), A90 (= A84), G91 (= G85), T140 (= T134), S142 (= S136), Y156 (= Y149), K160 (= K153), P186 (= P179), G188 (≠ A181), T189 (≠ V182), T191 (≠ G184)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
32% identity, 93% coverage: 10:248/257 of query aligns to 8:242/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
33% identity, 93% coverage: 10:248/257 of query aligns to 5:235/239 of 3sj7A
- active site: G12 (= G17), S138 (= S136), Q148 (≠ R146), Y151 (= Y149), K155 (= K153)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (≠ A13), S10 (≠ G15), R11 (≠ S16), I13 (= I18), N31 (≠ T36), Y32 (≠ D37), A33 (≠ V38), G34 (≠ S39), S35 (≠ A40), A58 (vs. gap), N59 (vs. gap), V60 (vs. gap), N86 (= N83), A87 (= A84), T109 (≠ V107), S138 (= S136), Y151 (= Y149), K155 (= K153), P181 (= P179), G182 (= G180)
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
34% identity, 96% coverage: 10:257/257 of query aligns to 13:256/259 of 6ci9D
- active site: G20 (= G17), S145 (= S136), Y159 (= Y149)
- binding 1-aminopropan-2-one: F97 (≠ A87), S145 (= S136), T147 (≠ A138), W156 (≠ R146), Y159 (= Y149), G190 (= G180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (≠ A13), S18 (≠ G15), G20 (= G17), I21 (= I18), G40 (≠ D37), R41 (≠ V38), N42 (≠ S39), D66 (= D56), V67 (≠ A57), N93 (= N83), G95 (= G85), T143 (= T134), S145 (= S136), Y159 (= Y149), K163 (= K153), P189 (= P179), N191 (≠ A181), I192 (≠ V182), T194 (≠ M187), G196 (= G189), L197 (≠ V190)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
35% identity, 93% coverage: 10:248/257 of query aligns to 9:235/240 of 4dmmB
- active site: G16 (= G17), S142 (= S136), Q152 (≠ R146), Y155 (= Y149), K159 (= K153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (≠ A13), S14 (≠ G15), R15 (≠ S16), G16 (= G17), I17 (= I18), A37 (≠ V38), S38 (= S39), S39 (≠ A40), A62 (vs. gap), D63 (= D56), V64 (≠ A57), N90 (= N83), A91 (= A84), L113 (≠ V107), I140 (≠ T134), S142 (= S136), Y155 (= Y149), K159 (= K153), P185 (= P179), G186 (= G180), I188 (≠ V182), T190 (≠ P185), M192 (= M187)
Q8JZV9 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Mus musculus (Mouse) (see paper)
33% identity, 93% coverage: 9:248/257 of query aligns to 9:241/245 of Q8JZV9
- Y147 (= Y149) active site, Proton acceptor; mutation to F: Loss of function.
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 93% coverage: 10:248/257 of query aligns to 9:243/248 of 4urfB
- active site: G16 (= G17), S142 (= S136), I152 (≠ R146), Y155 (= Y149), K159 (= K153)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ M215), R211 (= R216), R212 (≠ S217)
- binding bicarbonate ion: I92 (= I86), G94 (= G88), R109 (≠ T103), R179 (= R173), S228 (= S233)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A13), G14 (= G15), N15 (≠ S16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (≠ V38), D62 (= D59), T63 (≠ E60), N89 (= N83), A90 (= A84), G91 (= G85), I140 (≠ T134), Y155 (= Y149), K159 (= K153), P185 (= P179), A186 (≠ G180), I188 (≠ V182), T190 (≠ G184)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 93% coverage: 10:248/257 of query aligns to 9:243/248 of 4urfA
- active site: G16 (= G17), S142 (= S136), I152 (≠ R146), Y155 (= Y149), K159 (= K153)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I86), S93 (≠ A87), G94 (= G88), E95 (vs. gap), T97 (vs. gap), E101 (≠ L92), T103 (≠ E94), Q106 (≠ D100), R109 (≠ T103), S175 (≠ P169), G177 (= G171)
- binding magnesium ion: S237 (≠ Q242), Y238 (≠ V243)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A13), G14 (= G15), N15 (≠ S16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (≠ V38), W41 (vs. gap), D62 (= D59), T63 (≠ E60), N89 (= N83), A90 (= A84), G91 (= G85), I140 (≠ T134), Y155 (= Y149), K159 (= K153), P185 (= P179), I188 (≠ V182), T190 (≠ G184)
Query Sequence
>GFF829 FitnessBrowser__Phaeo:GFF829
MSAEGMHRVLITAGGSGIGRAMAEGFAAAGHQVWVTDVSAEALADVPEGWRTTVVDATDE
AGVKGLFAEITVEWGGLDVLCANAGIAGPTALIEDIALEDWRTCVSVNLEGCFLAAKYAA
PMMKAAKAGAIIVTSSTAGQYGYPNRAPYASAKWAVIGLMKTLAMELGPFGIRANVICPG
AVEGPRMEGVLEREAAAKGMTRDQVYEGYASGTSMRSFVEAQDIANMAVFLGSDAARLVS
GQVIAVDGHTENPDPKV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory