SitesBLAST
Comparing GFF834 FitnessBrowser__Marino:GFF834 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
36% identity, 63% coverage: 135:379/389 of query aligns to 59:305/306 of 5mh6A
- binding 2-Ketohexanoic acid: R64 (≠ S140), A65 (= A141), G66 (= G142), H89 (≠ F165), R224 (= R298), H272 (= H346), Y280 (≠ W354)
- binding magnesium ion: T130 (≠ R203), A132 (≠ E205), F210 (= F284), E211 (≠ K285), M213 (= M287), G225 (= G299), P226 (= P300), V228 (= V302), E230 (≠ T304), D241 (≠ E315), S251 (≠ E325)
- binding nicotinamide-adenine-dinucleotide: A65 (= A141), G66 (= G142), T86 (≠ R162), H89 (≠ F165), G142 (= G215), T143 (≠ S216), L144 (≠ I217), R164 (= R237), P196 (= P270), T201 (= T275), V222 (≠ I296), A223 (≠ G297), R224 (= R298), H272 (= H346), S274 (≠ A348)
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
36% identity, 63% coverage: 135:379/389 of query aligns to 61:307/308 of 5mhaB
- binding 2-Ketohexanoic acid: R66 (≠ S140), R226 (= R298), H274 (= H346), Y282 (≠ W354)
- binding (2R)-2-hydroxyhexanoic acid: R66 (≠ S140), A67 (= A141), G68 (= G142), H91 (≠ F165), Y282 (≠ W354)
- binding magnesium ion: F212 (= F284), E213 (≠ K285), M215 (= M287), D243 (≠ E315)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A141), G68 (= G142), T88 (≠ R162), L143 (≠ A214), G144 (= G215), T145 (≠ S216), L146 (≠ I217), R165 (≠ A236), R166 (= R237), S167 (≠ K238), P180 (≠ N252), T197 (≠ A269), P198 (= P270), T203 (= T275), V224 (≠ I296), A225 (≠ G297), R226 (= R298), H274 (= H346), S276 (≠ A348)
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
36% identity, 63% coverage: 135:379/389 of query aligns to 61:307/308 of 5mhaA
- binding 2-Ketohexanoic acid: R66 (≠ S140), A67 (= A141), G68 (= G142), H91 (≠ F165), R226 (= R298), H274 (= H346), Y282 (≠ W354)
- binding magnesium ion: T132 (≠ R203), A134 (≠ E205)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A141), G68 (= G142), T88 (≠ R162), L143 (≠ A214), G144 (= G215), T145 (≠ S216), L146 (≠ I217), R165 (≠ A236), R166 (= R237), S167 (≠ K238), P180 (≠ N252), T197 (≠ A269), P198 (= P270), T203 (= T275), V224 (≠ I296), A225 (≠ G297), R226 (= R298), H274 (= H346), S276 (≠ A348)
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
36% identity, 63% coverage: 135:379/389 of query aligns to 61:307/308 of 5mh5A
- binding 2-Ketohexanoic acid: R66 (≠ S140), A67 (= A141), G68 (= G142), H91 (≠ F165), R226 (= R298), H274 (= H346), Y282 (≠ W354)
- binding magnesium ion: T132 (≠ R203), A134 (≠ E205), F212 (= F284), E213 (≠ K285), M215 (= M287), D243 (≠ E315)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A67 (= A141), G68 (= G142), T88 (≠ R162), G142 (= G213), L143 (≠ A214), G144 (= G215), T145 (≠ S216), L146 (≠ I217), R165 (≠ A236), R166 (= R237), S167 (≠ K238), T197 (≠ A269), P198 (= P270), T203 (= T275), V224 (≠ I296), A225 (≠ G297), R226 (= R298), H274 (= H346), S276 (≠ A348)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
35% identity, 65% coverage: 132:385/389 of query aligns to 65:315/315 of 5vg6B
- active site: M98 (≠ F165), R230 (= R298), D254 (= D322), E259 (= E327), H278 (= H346)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A141), R92 (≠ N160), M102 (≠ I169), L147 (≠ A214), G148 (= G215), D149 (≠ S216), L150 (≠ I217), W168 (≠ I235), S169 (≠ A236), R170 (= R237), T171 (≠ K238), K173 (≠ R240), L201 (≠ A269), P202 (= P270), T207 (= T275), V228 (≠ I296), R230 (= R298), H278 (= H346), A280 (= A348), S281 (≠ G349), Y315 (= Y385)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
34% identity, 56% coverage: 132:349/389 of query aligns to 66:282/316 of 4zqbB
- active site: L99 (≠ F165), R231 (= R298), E260 (= E327), H279 (= H346)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (≠ T157), M103 (≠ I169), G147 (= G213), L148 (≠ A214), G149 (= G215), E150 (≠ S216), L151 (≠ I217), W169 (≠ I235), S170 (≠ A236), R171 (= R237), S172 (≠ K238), K174 (= K241), L202 (≠ A269), P203 (= P270), F229 (≠ I296), R231 (= R298), H279 (= H346), S281 (≠ A348), A282 (≠ G349)
Sites not aligning to the query:
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
29% identity, 66% coverage: 126:383/389 of query aligns to 61:325/334 of 5aovA
- active site: L100 (≠ F165), R241 (= R298), D265 (= D322), E270 (= E327), H288 (= H346)
- binding glyoxylic acid: Y74 (≠ T139), A75 (≠ S140), V76 (≠ A141), G77 (= G142), R241 (= R298), H288 (= H346)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A141), T104 (≠ I169), F158 (≠ A214), G159 (= G215), R160 (≠ S216), I161 (= I217), S180 (≠ A236), R181 (= R237), A211 (= A268), V212 (≠ A269), P213 (= P270), T218 (= T275), I239 (= I296), A240 (≠ G297), R241 (= R298), H288 (= H346), G290 (≠ A348)
Sites not aligning to the query:
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
32% identity, 55% coverage: 133:347/389 of query aligns to 71:290/324 of 2gcgA
- active site: L103 (≠ F165), R241 (= R298), D265 (= D322), E270 (= E327), H289 (= H346)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (= S140), V79 (≠ A141), G80 (= G142), R241 (= R298), H289 (= H346)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (≠ A141), T107 (≠ I169), G156 (= G213), G158 (= G215), I160 (= I217), G180 (≠ A236), R181 (= R237), R184 (= R240), C212 (≠ A269), S213 (≠ P270), T218 (= T275), I239 (= I296), R241 (= R298), D265 (= D322), H289 (= H346)
Sites not aligning to the query:
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
32% identity, 55% coverage: 133:347/389 of query aligns to 75:294/328 of Q9UBQ7
Sites not aligning to the query:
- 293:296 binding
- 295 binding
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
34% identity, 58% coverage: 128:352/389 of query aligns to 59:284/304 of 1wwkA
- active site: S96 (≠ F165), R230 (= R298), D254 (= D322), E259 (= E327), H278 (= H346)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ I169), G146 (= G213), F147 (≠ A214), G148 (= G215), R149 (≠ S216), I150 (= I217), Y168 (≠ I235), D169 (≠ A236), P170 (≠ R237), V201 (≠ A269), P202 (= P270), T207 (= T275), T228 (≠ I296), S229 (≠ G297), D254 (= D322), H278 (= H346), G280 (≠ A348)
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
32% identity, 66% coverage: 130:385/389 of query aligns to 60:316/316 of 4z0pA
- active site: L95 (≠ I169), R231 (= R298), G250 (≠ A317), D255 (= D322), E260 (= E327), H279 (= H346)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (≠ N160), M99 (vs. gap), M144 (≠ A214), G145 (= G215), V146 (≠ S216), L147 (≠ I217), W165 (≠ I235), S166 (≠ A236), R167 (= R237), S168 (≠ K238), R170 (= R240), L197 (≠ A269), P198 (= P270), A229 (≠ I296), G230 (= G297), R231 (= R298), H279 (= H346), A281 (= A348), A282 (≠ G349), Y316 (= Y385)
- binding oxalic acid: G70 (≠ S140), A71 (= A141), G72 (= G142), H114 (≠ F184), R115 (≠ P185), R231 (= R298), H279 (= H346)
Sites not aligning to the query:
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
32% identity, 66% coverage: 130:385/389 of query aligns to 60:316/316 of 4weqA
- active site: L95 (≠ I169), R231 (= R298), G250 (≠ A317), D255 (= D322), E260 (= E327), H279 (= H346)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (≠ N160), M99 (vs. gap), M144 (≠ A214), G145 (= G215), V146 (≠ S216), L147 (≠ I217), W165 (≠ I235), S166 (≠ A236), R167 (= R237), S168 (≠ K238), R170 (= R240), L197 (≠ A269), P198 (= P270), A229 (≠ I296), G230 (= G297), R231 (= R298), D255 (= D322), H279 (= H346), A281 (= A348), Y316 (= Y385)
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
29% identity, 64% coverage: 132:379/389 of query aligns to 65:310/311 of 3bazA
- active site: L98 (≠ F165), R230 (= R298), A251 (= A319), D254 (= D322), E259 (= E327), H277 (= H346)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ A141), G149 (= G213), L150 (≠ A214), G151 (= G215), R152 (≠ S216), I153 (= I217), S172 (≠ A236), R173 (= R237), S174 (≠ K238), C201 (≠ A269), P202 (= P270), T207 (= T275), I228 (= I296), G229 (= G297), R230 (= R298), D254 (= D322), H277 (= H346), G279 (≠ A348)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
29% identity, 64% coverage: 132:379/389 of query aligns to 67:312/313 of Q65CJ7
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
35% identity, 46% coverage: 206:383/389 of query aligns to 149:324/332 of 6biiA
- active site: R240 (= R298), D264 (= D322), E269 (= E327), H287 (= H346)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G156 (= G213), F157 (≠ A214), G158 (= G215), R159 (≠ S216), I160 (= I217), A179 (= A236), R180 (= R237), S181 (≠ K238), K183 (≠ R240), V211 (≠ A269), P212 (= P270), E216 (≠ Q274), T217 (= T275), V238 (≠ I296), A239 (≠ G297), R240 (= R298), D264 (= D322), H287 (= H346), G289 (≠ A348)
Sites not aligning to the query:
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
28% identity, 69% coverage: 114:382/389 of query aligns to 51:319/533 of O43175
- T78 (≠ A141) binding
- R135 (≠ H198) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ SI 216:217) binding
- D175 (≠ K238) binding
- T207 (≠ A269) binding
- CAR 234:236 (≠ IGR 296:298) binding
- D260 (= D322) binding
- V261 (= V323) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HMAG 346:349) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
30% identity, 60% coverage: 114:347/389 of query aligns to 45:278/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ F165), A100 (≠ I169), R149 (≠ S216), I150 (= I217), Y168 (≠ R237), D169 (≠ K238), P170 (= P239), I171 (≠ R240), H200 (≠ A268), T201 (≠ A269), P202 (= P270), T207 (= T275), C228 (≠ I296), A229 (≠ G297), R230 (= R298), H277 (= H346)
Sites not aligning to the query:
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
30% identity, 60% coverage: 114:347/389 of query aligns to 45:278/297 of 6rj3A
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
30% identity, 60% coverage: 114:347/389 of query aligns to 43:276/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G215), I148 (= I217), Y166 (≠ R237), D167 (≠ K238), P168 (= P239), I169 (≠ R240), I170 (≠ K241), H198 (≠ A268), T199 (≠ A269), L208 (= L278), R228 (= R298)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
30% identity, 60% coverage: 114:347/389 of query aligns to 46:279/301 of 6rj5A
Query Sequence
>GFF834 FitnessBrowser__Marino:GFF834
MDGLYKTKNHIDDVRESTAINAVSGNSGASQVDPTEPADQTVITPRGNDQFNEVIHQKGG
GSMTQHSKPVVTVLTAPGEQEPPGMDAVRARADVRFACDEPTLRDTLPGTDIMMVTDFRT
EALAAAWHTADKLQWIHATSAGVDALMFPDLIRGDVTVTNARGIFDRTIAEYVLCTILMF
AKDFPNSIRLQMKHQWKHRDTERAEGKQVLVVGAGSIGRQIGRLVGAAGLKAHGIARKPR
KEDPDFVAVHGNDDLYEQLGHADFVVIAAPLTPQTEGLFDEKAFKAMKNSARLINIGRGP
IVKTDDLITALENGEIAGAGLDVFEEEPLAEDHPLWDMENVTMTAHMAGDFIGWKRALTD
QFLENFDRWHKGDELFNLVDKELGYAGSK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory