Comparing GFF836 Psest_0850 glucokinase, proteobacterial type to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
1sz2B Crystal structure of e. Coli glucokinase in complex with glucose (see paper)
39% identity, 99% coverage: 2:317/319 of query aligns to 2:316/320 of 1sz2B
6vzzA Crystal structure of glucokinase from balamuthia mandrillaris in complex with glucose (see paper)
31% identity, 78% coverage: 8:256/319 of query aligns to 30:314/374 of 6vzzA
8dtcA Crystal structure of glucokinase with bound glucose from acanthamoeba castellanii
29% identity, 78% coverage: 8:256/319 of query aligns to 30:313/374 of 8dtcA
2q2rA Trypanosoma cruzi glucokinase in complex with beta-d-glucose and adp (see paper)
29% identity, 76% coverage: 3:244/319 of query aligns to 30:292/370 of 2q2rA
Sites not aligning to the query:
5brhA Crystal structure of trypanosoma cruzi glucokinase in complex with inhibitor dbt-glcn (see paper)
28% identity, 76% coverage: 3:244/319 of query aligns to 24:289/367 of 5brhA
5breA Crystal structure of trypanosoma cruzi glucokinase in complex with inhibitor cbz-glcn (see paper)
28% identity, 76% coverage: 3:244/319 of query aligns to 24:289/367 of 5breA
5brdA Crystal structure of trypanosoma cruzi glucokinase in complex with inhibitor benz-glcn (see paper)
28% identity, 76% coverage: 3:244/319 of query aligns to 24:289/367 of 5brdA
5brfA Crystal structure of trypanosoma cruzi glucokinase in complex with inhibitor hpop-glcn (see paper)
28% identity, 76% coverage: 3:244/319 of query aligns to 24:286/364 of 5brfA
Sites not aligning to the query:
6da0A Crystal structure of glucokinase (nfhk) from naegleria fowleri (see paper)
24% identity, 83% coverage: 8:273/319 of query aligns to 32:329/378 of 6da0A
>GFF836 Psest_0850 glucokinase, proteobacterial type
MRLALVGDIGGTNARFALWRDSRLESVRVLAAADFATPEMAVEYYLASLGLAPGSVEAAC
LACAGPVKGEQFTFTNNHWRLTRSDFCGALQMGELLLINDFAAMALGMTRVGEAGRRMIC
AGEAEPDAPALVIGPGTGLGVAGLLPLGGGSWRALPGEGGHVDLPVADAHEAALWQMLFA
QLGHVRAEDVLSGGGLLLLYRTVCTVAGLAPRLASPAEVTAAALAGDHVAVATLEQFCVW
LGRVAGNNVLTLGARGGVYIVGGVVPRFADFFAASGFARGFTSKGCMSRYLGDVPVWLVT
AEFPGLEGAGVALEQALAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory