Comparing GFF84 FitnessBrowser__Phaeo:GFF84 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6qp3A Crystal structure of the plp-bound c-s lyase from bacillus subtilis (strain 168) (see paper)
38% identity, 99% coverage: 1:387/390 of query aligns to 1:387/387 of 6qp3A
4dq6A Crystal structure of plp-bound putative aminotransferase from clostridium difficile 630
34% identity, 99% coverage: 2:387/390 of query aligns to 4:388/388 of 4dq6A
1c7oA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate-l-aminoethoxyvinylglycine complex (see paper)
34% identity, 100% coverage: 2:390/390 of query aligns to 4:394/394 of 1c7oA
1c7nA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate cofactor (see paper)
34% identity, 100% coverage: 2:390/390 of query aligns to 4:394/394 of 1c7nA
5z0qC Crystal structure of ovob (see paper)
34% identity, 99% coverage: 1:387/390 of query aligns to 1:376/379 of 5z0qC
3l8aB Crystal structure of metc from streptococcus mutans
33% identity, 97% coverage: 8:386/390 of query aligns to 9:383/385 of 3l8aB
3b1eA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: alpha-aminoacrylate form (see paper)
32% identity, 98% coverage: 2:382/390 of query aligns to 4:381/387 of 3b1eA
3b1dA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: external aldimine form (see paper)
32% identity, 98% coverage: 2:382/390 of query aligns to 4:381/387 of 3b1dA
3b1cA Crystal structure of betac-s lyase from streptococcus anginosus: internal aldimine form (see paper)
32% identity, 98% coverage: 2:382/390 of query aligns to 4:381/387 of 3b1cA
7qugA Crystal structure of carbon-sulfur lyase fnapatb1 from fusobacterium nucleatum subspecies animalis in complex with allyl-cysteine (see paper)
31% identity, 99% coverage: 2:388/390 of query aligns to 3:396/397 of 7qugA
6qp2A Crystal structure of the plp-bound c-s lyase from staphylococcus hominis (see paper)
32% identity, 99% coverage: 2:388/390 of query aligns to 2:380/383 of 6qp2A
6qp1B Crystal structure of the plp-bound c-s lyase in the external aldimine form from staphylococcus hominis complexed with an inhibitor, l- cycloserine. (see paper)
32% identity, 99% coverage: 2:386/390 of query aligns to 9:397/398 of 6qp1B
8bobA Structural basis for negative regulation of the maltose system (see paper)
30% identity, 99% coverage: 1:386/390 of query aligns to 2:386/390 of 8bobA
P23256 Protein MalY; EC 4.4.1.13 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 99% coverage: 1:386/390 of query aligns to 2:386/390 of P23256
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
27% identity, 92% coverage: 32:388/390 of query aligns to 28:384/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
27% identity, 92% coverage: 32:388/390 of query aligns to 28:384/388 of 1gd9A
1j32A Aspartate aminotransferase from phormidium lapideum
21% identity, 92% coverage: 28:384/390 of query aligns to 26:382/388 of 1j32A
5yhvA Crystal structure of an aminotransferase from mycobacterium tuberculosis
25% identity, 80% coverage: 70:382/390 of query aligns to 80:387/394 of 5yhvA
Sites not aligning to the query:
P96847 Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
25% identity, 80% coverage: 70:382/390 of query aligns to 74:381/388 of P96847
5yhvB Crystal structure of an aminotransferase from mycobacterium tuberculosis
25% identity, 80% coverage: 70:382/390 of query aligns to 73:380/387 of 5yhvB
Sites not aligning to the query:
>GFF84 FitnessBrowser__Phaeo:GFF84
MNFDKIIDRRNTHCIKWDMMEDLYNVPRDEGLSMWVADMDFAVPSVVTDKMREMADHGVY
GYVNCDSPYKSAICWWMQNRHGWSVDPEAIFTTTGLVNGVGMCLDTFTQQGDGIVLFTPV
YHAFAKVIRNAGREVVECELAVNDGRYEMDFSTYDAQMTGAEKMVILCSPHNPVGRVWTE
EELRGVADFAKRHDLILLSDEIHHDLVFDGATHIPMQNAAPDITDRLLMLTAPSKTFNFA
GMHTGQVIIPDPELRAKFSRRMMALALSPNSPGQWATAAAYSPEGAAWVDELVPYLDGNR
QLFDAAVNEIPGLHSTRLEATYLAWVDFSGTGMSREEFTARVEQGAKIAANHGPSFGTGG
ENFLRFNLGTQRARVEEACDRLRNAFSDLQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory