SitesBLAST
Comparing GFF846 FitnessBrowser__Marino:GFF846 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2zatA Crystal structure of a mammalian reductase (see paper)
39% identity, 95% coverage: 9:252/256 of query aligns to 3:246/251 of 2zatA
- active site: G16 (= G22), S142 (= S148), L152 (≠ Q158), Y155 (= Y161), K159 (= K165), K200 (≠ E206)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A12 (≠ G18), T14 (≠ S20), D15 (≠ R21), G16 (= G22), I17 (= I23), S36 (= S42), R37 (= R43), K38 (= K44), N41 (≠ G47), H62 (= H68), N89 (= N95), A91 (= A97), V140 (= V146), S142 (= S148), Y155 (= Y161), K159 (= K165), P185 (= P191), G186 (= G192), I188 (≠ T194), T190 (= T196), F192 (= F198), S193 (≠ A199)
Q8WNV7 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; PHCR; NADPH-dependent retinol dehydrogenase/reductase; NDRD; Peroxisomal carbonyl reductase; PerCR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; EC 1.1.1.184; EC 1.1.1.300 from Sus scrofa (Pig) (see 2 papers)
39% identity, 95% coverage: 9:252/256 of query aligns to 31:274/279 of Q8WNV7
- 37:61 (vs. 15:39, 56% identical) binding
- F177 (≠ G155) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to S: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with F-180.
- L180 (≠ Q158) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to F: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with S-177.
- Y183 (= Y161) active site, Proton acceptor
- K187 (= K165) binding
- N196 (≠ S174) Important for the maintenance of the quaternary structure, the catalytic activity and cold stability
Sites not aligning to the query:
- 277:279 Peroxisomal targeting signal
Q9BTZ2 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4; EC 1.1.1.184 from Homo sapiens (Human) (see 2 papers)
38% identity, 95% coverage: 9:252/256 of query aligns to 30:273/278 of Q9BTZ2
- S176 (≠ G155) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to F: Decreased reduction activity for benzil, isatin and retinal and increased activity for 5beta-Pregnane-3,20-dione and 5beta-Dihydrotestosterone. No change of stereoselectivity in 3-ketosteroids reduction and no change in 3beta-hydroxysteroid oxidation. Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with L-179. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with L-179. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with L-179. Loss of cold catalytic inactivation; when associated with L-179 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with L-179 and N-195.
- F179 (≠ Q158) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to L: Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with F-176. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with F-176. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176. Loss of cold catalytic inactivation; when associated with F-176 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and N-195.
- T195 (≠ S174) mutation to N: Loss of cold catalytic inactivation. Loss of cold catalytic inactivation; when associated with F-176 and L-179. Switch in stereoselective activity from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176 and L-179. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and L-179.
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
38% identity, 95% coverage: 9:252/256 of query aligns to 6:249/254 of 3o4rA
- active site: G19 (= G22), S145 (= S148), F155 (≠ Q158), Y158 (= Y161), K162 (= K165), K203 (≠ E206)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G18), T17 (≠ S20), D18 (≠ R21), G19 (= G22), I20 (= I23), S39 (= S42), R40 (= R43), K41 (= K44), N44 (≠ G47), H65 (= H68), V66 (≠ I69), N92 (= N95), A94 (= A97), S145 (= S148), Y158 (= Y161), K162 (= K165), P188 (= P191), G189 (= G192), L190 (= L193), I191 (≠ T194), T193 (= T196), F195 (= F198), S196 (≠ A199)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
32% identity, 97% coverage: 6:253/256 of query aligns to 1:249/252 of 1vl8B
- active site: G17 (= G22), S143 (= S148), I154 (= I160), Y157 (= Y161), K161 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G18), R16 (= R21), G17 (= G22), L18 (≠ I23), S37 (= S42), R38 (= R43), C63 (= C67), D64 (≠ H68), V65 (≠ I69), A91 (≠ N95), A92 (= A96), G93 (≠ A97), I94 (≠ A98), V114 (= V119), I141 (≠ V146), S143 (= S148), Y157 (= Y161), K161 (= K165), P187 (= P191), G188 (= G192), Y190 (≠ T194), T192 (= T196), M194 (≠ F198), T195 (≠ A199)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
34% identity, 98% coverage: 5:254/256 of query aligns to 2:246/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G18), R18 (= R21), G19 (= G22), I20 (= I23), D39 (≠ S42), R40 (= R43), C63 (= C67), I65 (= I69), N91 (= N95), G93 (≠ A97), I94 (≠ A98), V114 (= V119), Y155 (= Y161), K159 (= K165), I188 (≠ T194), T190 (= T196), T193 (≠ A199)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
35% identity, 97% coverage: 9:256/256 of query aligns to 3:248/248 of 6ixmC
- active site: G16 (= G22), S142 (= S148), Y155 (= Y161), K159 (= K165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), S15 (≠ R21), G16 (= G22), I17 (= I23), D36 (≠ S42), I37 (≠ R43), A61 (≠ C67), D62 (≠ H68), T63 (≠ I69), N89 (= N95), A90 (= A96), M140 (≠ V146), S142 (= S148), Y155 (= Y161), K159 (= K165), P185 (= P191), A186 (≠ G192), Y187 (≠ L193), I188 (≠ T194), L192 (≠ F198)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
35% identity, 97% coverage: 7:254/256 of query aligns to 3:247/249 of 3uf0A
- active site: G18 (= G22), S141 (= S148), V151 (≠ Q158), Y154 (= Y161), K158 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G18), S17 (≠ R21), G18 (= G22), I19 (= I23), R39 (= R43), D63 (≠ H68), L64 (≠ I69), N89 (= N95), G91 (≠ A97), I92 (≠ A98), I139 (≠ V146), A140 (= A147), S141 (= S148), Y154 (= Y161), K158 (= K165), P184 (= P191), G185 (= G192), V187 (≠ T194), T189 (= T196), N191 (≠ F198), T192 (≠ A199)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
35% identity, 96% coverage: 9:254/256 of query aligns to 3:252/256 of 7do7A
- active site: G16 (= G22), S146 (= S148), Y159 (= Y161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), R15 (= R21), G16 (= G22), I17 (= I23), S37 (≠ R43), D66 (≠ H68), A67 (≠ I69), N93 (= N95), A94 (= A96), G95 (≠ A97), I96 (≠ A98), V144 (= V146), S145 (≠ A147), S146 (= S148), Y159 (= Y161), K163 (= K165), P189 (= P191), G190 (= G192), I192 (≠ T194), T194 (= T196), I196 (≠ F198)
- binding beta-L-rhamnopyranose: F99 (= F102), S146 (= S148), S148 (≠ N150), Q156 (= Q158), Y159 (= Y161), N197 (≠ A199), D235 (= D237), M236 (≠ A238), R238 (≠ S240)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
35% identity, 96% coverage: 9:254/256 of query aligns to 3:252/256 of 7b81A
- active site: G16 (= G22), S146 (= S148), Y159 (= Y161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), S14 (= S20), R15 (= R21), I17 (= I23), D66 (≠ H68), A67 (≠ I69), N93 (= N95), A94 (= A96), G95 (≠ A97), I96 (≠ A98), T116 (≠ V119), V144 (= V146), S146 (= S148), Y159 (= Y161), K163 (= K165), P189 (= P191), G190 (= G192), I192 (≠ T194), T194 (= T196), I196 (≠ F198)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
37% identity, 94% coverage: 12:252/256 of query aligns to 5:243/246 of 3osuA
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
35% identity, 96% coverage: 9:254/256 of query aligns to 3:243/247 of 7do6A
- active site: G16 (= G22), S146 (= S148), Y159 (= Y161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (= S20), R15 (= R21), G16 (= G22), I17 (= I23), H36 (≠ S42), S37 (≠ R43), G42 (vs. gap), D66 (≠ H68), A67 (≠ I69), N93 (= N95), A94 (= A96), G95 (≠ A97), I96 (≠ A98), T116 (≠ V119), S146 (= S148), Y159 (= Y161), K163 (= K165), I192 (≠ T204)
5jc8D Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
36% identity, 95% coverage: 9:252/256 of query aligns to 4:256/262 of 5jc8D
Q9S9W2 Short-chain dehydrogenase/reductase SDRA; Protein INDOLE-3-BUTYRIC ACID RESPONSE 1; Short-chain dehydrogenase/reductase A; EC 1.1.-.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 98% coverage: 1:252/256 of query aligns to 1:249/254 of Q9S9W2
- R43 (= R43) mutation to C: In ibr1-1; resistance to the inhibitory effect of intermediate levels of indole-3-butyric acid (IBA) on root elongation.
- S140 (= S142) mutation to F: In ibr1-8; resistance to the inhibitory effect of intermediate levels of indole-3-butyric acid (IBA) on root elongation.
8hsaA Brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant: 1-53 truncation/m196i/i258m/k262t-NAD+
37% identity, 96% coverage: 7:252/256 of query aligns to 3:245/248 of 8hsaA
- binding nicotinamide-adenine-dinucleotide: G14 (= G18), I19 (= I23), D38 (≠ S42), L39 (≠ R43), C63 (= C67), N64 (≠ H68), V65 (≠ I69), N91 (= N95), A92 (= A96), G93 (vs. gap), I140 (≠ V146), S141 (≠ A147), Y155 (= Y161), K159 (= K165), P185 (= P191), G186 (= G192)
G9FRD7 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NADP-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.- from Clostridium sardiniense (Clostridium absonum) (see 2 papers)
33% identity, 96% coverage: 9:253/256 of query aligns to 4:249/262 of G9FRD7
- SSTRGI 13:18 (≠ GASRGI 18:23) binding
- R38 (= R43) binding ; mutation to D: Loss of catalytic activity.
- NA 63:64 (≠ HI 68:69) binding
- N90 (= N95) binding
- T145 (≠ S148) binding
- Y158 (= Y161) binding ; binding
- K162 (= K165) binding
- IGTRA 191:195 (≠ TDTKF 194:198) binding
Sites not aligning to the query:
- 261:262 mutation Missing: 5-fold reduction in catalytic efficiency.
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 94% coverage: 12:252/256 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G22), S138 (= S148), Q148 (= Q158), Y151 (= Y161), K155 (= K165)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), S10 (= S20), R11 (= R21), I13 (= I23), N31 (≠ S41), Y32 (vs. gap), A33 (≠ S42), G34 (≠ R43), S35 (≠ K44), A58 (≠ C67), N59 (≠ H68), V60 (≠ I69), N86 (= N95), A87 (= A96), T109 (≠ V119), S138 (= S148), Y151 (= Y161), K155 (= K165), P181 (= P191), G182 (= G192)
5epoA The three-dimensional structure of clostridium absonum 7alpha- hydroxysteroid dehydrogenase (see paper)
33% identity, 96% coverage: 9:253/256 of query aligns to 3:248/261 of 5epoA
- active site: G16 (= G22), T144 (≠ S148), I152 (≠ H156), Y157 (= Y161), K161 (= K165), R193 (≠ K197)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S12 (≠ G18), T14 (≠ S20), R15 (= R21), G16 (= G22), I17 (= I23), R37 (= R43), F61 (≠ C67), N62 (≠ H68), N89 (= N95), Y90 (≠ A96), G91 (≠ A97), Y157 (= Y161), K161 (= K165), P187 (= P191), G188 (= G192), I190 (≠ T194), T192 (= T196), R193 (≠ K197), A194 (≠ F198), A195 (= A199)
- binding taurochenodeoxycholic acid: T93 (vs. gap), T144 (≠ S148), G146 (≠ N150), R154 (≠ Q158), Y157 (= Y161), G188 (= G192), N198 (≠ L202), M199 (≠ T203), F203 (≠ I208)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
33% identity, 96% coverage: 9:253/256 of query aligns to 4:257/260 of 6zzqA
- active site: G17 (= G22), S142 (= S148), Y155 (= Y161)
- binding acetoacetic acid: Q94 (≠ N99), S142 (= S148), K152 (≠ Q158), Y155 (= Y161), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), S16 (≠ R21), G17 (= G22), I18 (= I23), D37 (≠ S42), M38 (≠ R43), D63 (≠ H68), V64 (≠ I69), N90 (= N95), A91 (= A96), G92 (≠ A97), M140 (≠ V146), A141 (= A147), S142 (= S148), Y155 (= Y161), K159 (= K165), Y187 (≠ L193), V188 (≠ T194), T190 (= T196)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
33% identity, 96% coverage: 9:253/256 of query aligns to 5:258/261 of 6zzsD
- active site: G18 (= G22), S143 (= S148), Y156 (= Y161)
- binding nicotinamide-adenine-dinucleotide: G14 (= G18), S17 (≠ R21), I19 (= I23), D38 (≠ S42), M39 (≠ R43), D64 (≠ H68), V65 (≠ I69), N91 (= N95), A92 (= A96), G93 (≠ A97), M141 (≠ V146), A142 (= A147), S143 (= S148), Y156 (= Y161), K160 (= K165), P186 (= P191), G187 (= G192), V189 (≠ T194), T191 (= T196), L193 (≠ F198)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ N99), S143 (= S148), N145 (= N150), K153 (≠ Q158), Y156 (= Y161), Q197 (vs. gap)
Query Sequence
>GFF846 FitnessBrowser__Marino:GFF846
MSSKNLFDLTGKVALITGASRGIGESIARTLAEYGAHVIVSSRKIDGCEAVASSIRDAGG
SAEAYACHIGDMDQIESIWAHIDQTHGKLDILVNNAAANPYFGPVEDTDLGAFNKTVDVN
IRGYFFMCARGAQMMKKAGGGSIVNVASVNGVNPGHYQGIYSVTKAAVISMTKSFAMELG
QQKIRVNALLPGLTDTKFASALTTNEAIKKQAMAHIPMKRVADPGEMAGTVLYLVSDASS
YTTGACINADGGYLTV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory