Comparing GFF855 FitnessBrowser__psRCH2:GFF855 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
55% identity, 98% coverage: 4:181/182 of query aligns to 4:182/188 of 3igjC
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
47% identity, 99% coverage: 2:181/182 of query aligns to 1:180/186 of 4isxA
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
39% identity, 98% coverage: 3:181/182 of query aligns to 1:180/190 of 5u2kA
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 99% coverage: 1:181/182 of query aligns to 1:181/203 of P07464
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
39% identity, 99% coverage: 1:181/182 of query aligns to 2:180/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
39% identity, 99% coverage: 1:181/182 of query aligns to 2:180/201 of 1kruA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
39% identity, 99% coverage: 1:181/182 of query aligns to 2:180/200 of 1krrA
Sites not aligning to the query:
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
41% identity, 99% coverage: 1:181/182 of query aligns to 2:180/185 of 3nz2J
Sites not aligning to the query:
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
41% identity, 98% coverage: 3:181/182 of query aligns to 1:177/183 of 3nz2C
Sites not aligning to the query:
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
39% identity, 96% coverage: 7:181/182 of query aligns to 2:170/176 of 3ectA
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
38% identity, 51% coverage: 89:181/182 of query aligns to 183:276/307 of A1ADJ6
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
38% identity, 47% coverage: 96:181/182 of query aligns to 65:139/290 of 4mzuB
Sites not aligning to the query:
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
38% identity, 47% coverage: 96:181/182 of query aligns to 65:140/294 of 4mzuF
Sites not aligning to the query:
7s42A Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-acetamido-3,6-dideoxy-d- galactose (see paper)
34% identity, 55% coverage: 69:168/182 of query aligns to 42:135/145 of 7s42A
7s41A Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-acetamido-3,6-dideoxy-d- glucose (see paper)
34% identity, 55% coverage: 69:168/182 of query aligns to 42:135/145 of 7s41A
7s3wA Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-amino-3,6-dideoxy-d- galactose (see paper)
34% identity, 55% coverage: 69:168/182 of query aligns to 42:135/145 of 7s3wA
7s3uA Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-amino-3,6-dideoxy-d-glucose (see paper)
34% identity, 55% coverage: 69:168/182 of query aligns to 42:135/145 of 7s3uA
7s45A Crystal structure of an n-acetyltransferase, c80t mutant, from helicobacter pullorum in the presence of acetyl coenzyme a and dtdp (see paper)
32% identity, 55% coverage: 69:168/182 of query aligns to 42:131/141 of 7s45A
4eaaA X-ray crystal structure of the h141n mutant of perosamine n- acetyltransferase from caulobacter crescentus in complex with coa and gdp-perosamine (see paper)
31% identity, 58% coverage: 78:182/182 of query aligns to 124:208/210 of 4eaaA
Sites not aligning to the query:
3fscA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-fucose (see paper)
32% identity, 59% coverage: 73:180/182 of query aligns to 108:217/259 of 3fscA
Sites not aligning to the query:
>GFF855 FitnessBrowser__psRCH2:GFF855
MAMSEKQKMLAGELYYPGDPEILADQAAAKAWMVRYNAALAASPDERRALLAERLASVGA
GAVIRPPFHCDYGYNIHLGEGAFLNFNCVILDVVEVHIGAGAQIGPAVQLYTADHPRDPE
ARRSGVEFGRPINIGRNVWVGGGAIILPGVTIGDDAVIGAGSVVTRDVPAGATVVGNPAR
IR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory