SitesBLAST
Comparing GFF856 FitnessBrowser__psRCH2:GFF856 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
58% identity, 99% coverage: 8:541/542 of query aligns to 4:535/535 of 3wy2A
- active site: D97 (= D101), R197 (= R201), D199 (= D203), E268 (= E272), H329 (= H333), D330 (= D334)
- binding beta-D-glucopyranose: D59 (= D63), Y62 (= Y66), H102 (= H106), R197 (= R201), D199 (= D203), E268 (= E272), H329 (= H333), D330 (= D334), R397 (= R402)
- binding glycerol: S101 (≠ N105), D169 (= D173), V170 (≠ L174), P175 (= P179), R178 (≠ Q182), Q179 (≠ D183), F203 (= F207), Y204 (= Y208), H206 (= H210), D240 (= D244), P244 (= P248), E280 (≠ A284)
- binding magnesium ion: D20 (= D24), R22 (≠ N26), V26 (= V30), D28 (= D32)
3wy1A Crystal structure of alpha-glucosidase (see paper)
58% identity, 99% coverage: 8:541/542 of query aligns to 4:535/535 of 3wy1A
- active site: D97 (= D101), R197 (= R201), D199 (= D203), E268 (= E272), H329 (= H333), D330 (= D334)
- binding glycerol: S101 (≠ N105), D169 (= D173), V170 (≠ L174), F203 (= F207), Y204 (= Y208), H206 (= H210)
- binding magnesium ion: D20 (= D24), D24 (= D28), V26 (= V30), D28 (= D32)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D63), Y62 (= Y66), H102 (= H106), F144 (= F148), F163 (= F167), R197 (= R201), D199 (= D203), T200 (≠ A204), G225 (= G229), E268 (= E272), F294 (= F298), H329 (= H333), D330 (= D334), R397 (= R402)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
58% identity, 99% coverage: 8:541/542 of query aligns to 4:535/535 of 3wy4A
- active site: D97 (= D101), R197 (= R201), D199 (= D203), Q268 (≠ E272), H329 (= H333), D330 (= D334)
- binding alpha-D-glucopyranose: D59 (= D63), Y62 (= Y66), H102 (= H106), I143 (≠ V147), F163 (= F167), D199 (= D203), T200 (≠ A204), G225 (= G229), Q268 (≠ E272), Q268 (≠ E272), F294 (= F298), H329 (= H333), D330 (= D334), R397 (= R402), R397 (= R402)
- binding glycerol: S101 (≠ N105), D169 (= D173), V170 (≠ L174), F203 (= F207), Y204 (= Y208), H206 (= H210), L224 (≠ I228), G225 (= G229), A226 (≠ V230), P227 (≠ R231), F294 (= F298), D330 (= D334), E374 (= E379), K395 (= K400), G396 (= G401), G399 (= G404)
- binding magnesium ion: D20 (= D24), D24 (= D28), V26 (= V30), D28 (= D32)
3wy4B Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
57% identity, 68% coverage: 8:374/542 of query aligns to 4:323/421 of 3wy4B
- active site: D75 (= D101), R175 (= R201), D177 (= D203), Q237 (≠ E272)
- binding glycerol: S79 (≠ N105), N140 (= N166), D147 (= D173), F181 (= F207), Y182 (= Y208), F183 (= F209), H184 (= H210), D209 (= D244)
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
35% identity, 93% coverage: 8:511/542 of query aligns to 2:522/555 of 4m56A
- active site: D95 (= D101), R195 (= R201), D197 (= D203), E250 (≠ A271), H326 (= H333), D327 (= D334)
- binding D-glucose: D57 (= D63), Y60 (= Y66), H100 (= H106), F142 (= F148), D197 (= D203), E250 (≠ A271), D327 (= D334), R413 (= R402)
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
35% identity, 93% coverage: 8:511/542 of query aligns to 2:522/556 of 5wczA
- active site: D95 (= D101), R195 (= R201), D197 (= D203), E250 (≠ A271), H326 (= H333), D327 (= D334)
- binding 1-deoxynojirimycin: D57 (= D63), Y60 (= Y66), H100 (= H106), F161 (= F167), D197 (= D203), V198 (≠ A204), E250 (≠ A271), H326 (= H333), D327 (= D334), R413 (= R402)
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
35% identity, 94% coverage: 5:511/542 of query aligns to 1:527/561 of O06994
- D20 (= D24) binding
- N22 (= N26) binding
- D24 (= D28) binding
- F26 (≠ V30) binding
- D28 (= D32) binding
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
35% identity, 93% coverage: 8:511/542 of query aligns to 2:525/559 of 4mazA
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
35% identity, 93% coverage: 8:511/542 of query aligns to 2:525/559 of 7lv6B
2ze0A Alpha-glucosidase gsj (see paper)
36% identity, 91% coverage: 6:499/542 of query aligns to 2:484/531 of 2ze0A
7p01A Structure of the maltase baag2 from blastobotrys adeninivorans in complex with acarbose (see paper)
33% identity, 93% coverage: 3:506/542 of query aligns to 2:537/572 of 7p01A
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: D62 (= D63), Y65 (= Y66), H105 (= H106), Y150 (≠ V147), F170 (= F167), D207 (= D203), T208 (≠ A204), E265 (= E272), F291 (= F298), H338 (= H333), D339 (= D334), R431 (= R402), T529 (≠ G498), D530 (= D499)
- binding calcium ion: D23 (= D24), N25 (= N26), D27 (= D28), I29 (≠ V30), D31 (= D32)
- binding alpha-D-glucopyranose: R224 (≠ G226), F291 (= F298), A295 (≠ T302), E300 (≠ Y309), S349 (≠ L344), D350 (≠ N345), D350 (≠ N345), A351 (≠ G346), Q427 (vs. gap), K428 (vs. gap)
- binding 1-methylpyrrolidin-2-one: S19 (≠ R20), I29 (≠ V30), M63 (≠ F64), H74 (≠ D75), W454 (= W426)
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
32% identity, 93% coverage: 6:508/542 of query aligns to 1:511/546 of 8ibkA
- binding calcium ion: D19 (= D24), N21 (= N26), D23 (= D28), I25 (≠ V30), D27 (= D32)
- binding alpha-D-glucopyranose: D58 (= D63), Y61 (= Y66), H101 (= H106), I141 (≠ V147), F161 (= F167), D197 (= D203), A198 (= A204), H201 (≠ F207), M227 (≠ I242), Q254 (≠ E272), Q254 (≠ E272), F280 (= F298), H320 (= H333), D321 (= D334), R405 (= R402)
Sites not aligning to the query:
6k5pC Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
34% identity, 95% coverage: 6:519/542 of query aligns to 2:504/531 of 6k5pC
- active site: D97 (= D101), R196 (= R201), D198 (= D203), E264 (= E277), H331 (= H333), D332 (= D334)
- binding calcium ion: N101 (= N105), D168 (= D173), H202 (≠ F207), M203 (≠ Y208), E205 (≠ H210)
- binding cobalt (ii) ion: H429 (≠ N450), H433 (≠ R454)
6k5pB Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
34% identity, 95% coverage: 6:519/542 of query aligns to 2:504/531 of 6k5pB
- active site: D97 (= D101), R196 (= R201), D198 (= D203), E264 (= E277), H331 (= H333), D332 (= D334)
- binding calcium ion: N101 (= N105), D168 (= D173), H202 (≠ F207), M203 (≠ Y208), E205 (≠ H210)
- binding magnesium ion: H7 (≠ G11), A8 (≠ G12)
6k5pA Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
34% identity, 95% coverage: 6:519/542 of query aligns to 2:504/531 of 6k5pA
4hphA The crystal structure of isomaltulose synthase mutant e295q from erwinia rhapontici nx5 in complex with its natural substrate sucrose (see paper)
33% identity, 93% coverage: 5:508/542 of query aligns to 3:521/559 of 4hphA
- active site: D99 (= D101), R198 (= R201), D200 (= D203), Q254 (≠ A271), H327 (= H333), D328 (= D334)
- binding calcium ion: D22 (= D24), N24 (= N26), D26 (= D28), I28 (≠ V30), D30 (= D32)
- binding beta-D-fructofuranose: F164 (= F167), Q254 (≠ A271), F256 (≠ I273), D328 (= D334), E387 (≠ G392), R415 (= R402)
- binding alpha-D-glucopyranose: D61 (= D63), Y64 (= Y66), H104 (= H106), F164 (= F167), D200 (= D203), Q254 (≠ A271), H327 (= H333), D328 (= D334), R415 (= R402)
4howA The crystal structure of isomaltulose synthase from erwinia rhapontici nx5 (see paper)
33% identity, 93% coverage: 5:508/542 of query aligns to 3:521/559 of 4howA
3gbeA Crystal structure of the isomaltulose synthase smua from protaminobacter rubrum in complex with the inhibitor deoxynojirimycin (see paper)
32% identity, 92% coverage: 8:507/542 of query aligns to 5:519/558 of 3gbeA
- active site: D98 (= D101), R197 (= R201), D199 (= D203), E253 (≠ A271), H326 (= H333), D327 (= D334)
- binding 1-deoxynojirimycin: D60 (= D63), Y63 (= Y66), H103 (= H106), F163 (= F167), R197 (= R201), D199 (= D203), H326 (= H333), D327 (= D334), R414 (= R402)
4hozA The crystal structure of isomaltulose synthase mutant d241a from erwinia rhapontici nx5 in complex with d-glucose (see paper)
33% identity, 93% coverage: 5:508/542 of query aligns to 3:521/559 of 4hozA
- active site: D99 (= D101), R198 (= R201), A200 (≠ D203), E254 (≠ A271), H327 (= H333), D328 (= D334)
- binding calcium ion: D22 (= D24), N24 (= N26), D26 (= D28), I28 (≠ V30), D30 (= D32)
- binding alpha-D-glucopyranose: D61 (= D63), Y64 (= Y66), H104 (= H106), F164 (= F167), R198 (= R201), A200 (≠ D203), E254 (≠ A271), H327 (= H333), D328 (= D334), R415 (= R402)
5do8B 1.8 angstrom crystal structure of listeria monocytogenes lmo0184 alpha-1,6-glucosidase (see paper)
31% identity, 94% coverage: 6:517/542 of query aligns to 2:533/553 of 5do8B
- active site: D97 (= D101), R193 (= R201), D195 (= D203), E252 (≠ R263), H325 (= H333), D326 (= D334)
- binding beta-D-glucopyranose: D59 (= D63), Y62 (= Y66), H102 (= H106), F159 (= F167), R193 (= R201), D195 (= D203), E252 (≠ R263), H325 (= H333), D326 (= D334), R411 (= R402)
Query Sequence
>GFF856 FitnessBrowser__psRCH2:GFF856
MSEQLQNWWRGGVIYQVYPRSFFDSNGDGVGDLPGVLHKLDYIASLNVDAIWLSPFFTSP
MKDFGYDVADYRGVDPLFGTLDDFVRLVEACHERGMRVLIDQVLNHSSDQHPWFAESRSS
RDNDKADWYVWADPKPDGTVPNNWLSVFGGPAWSWDSRRRQYYLHNFLSSQPDLNFHCPA
VQDQLLDDMEFWLKLGVDGFRLDAANFYFHDAELRDNPPNTEIREGSIGVRIDNPYAYQR
HIYDKTRPENMDFLRRLRALLQRYPGASSVAEIGCDESLRTMAAYTSGGDTLHMAYSFDL
LTEQCSPGYIRHTVEGIERELADGWSCWSMGNHDVVRVMTRWALNGRPDPERGRLLMALL
LSLRGSVCMYQGEELGLPEAELRYEDLVDPYGITFWPEFKGRDGCRTPMPWESEAHHAGF
TGSQPWLPVDDSHRSLSVAAQDADPHSMLNCYRRFLGWRREQRLLIEGDIHMVYHDDALL
VFERRLGDEAWLCLFNLGDLSRSYELPAQAVPLVDVPASFAEYDGHWARLPAHGFGYVRL
AG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory