Comparing GFF860 FitnessBrowser__Marino:GFF860 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
55% identity, 98% coverage: 5:257/257 of query aligns to 12:265/265 of P07821
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
34% identity, 82% coverage: 20:229/257 of query aligns to 20:228/278 of 8bmpA
Sites not aligning to the query:
5d3mA Folate ecf transporter: amppnp bound state (see paper)
34% identity, 82% coverage: 20:229/257 of query aligns to 23:231/280 of 5d3mA
Sites not aligning to the query:
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
33% identity, 82% coverage: 20:229/257 of query aligns to 20:228/278 of 8bmsA
Sites not aligning to the query:
E9Q876 Glucosylceramide transporter ABCA12; ATP-binding cassette sub-family A member 12; EC 7.6.2.1 from Mus musculus (Mouse) (see 2 papers)
32% identity, 82% coverage: 15:225/257 of query aligns to 1356:1561/2595 of E9Q876
Sites not aligning to the query:
4hluA Structure of the ecfa-a' heterodimer bound to adp (see paper)
33% identity, 82% coverage: 20:231/257 of query aligns to 23:228/265 of 4hluA
Sites not aligning to the query:
4zirA Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
33% identity, 82% coverage: 20:231/257 of query aligns to 23:226/263 of 4zirA
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
30% identity, 95% coverage: 7:250/257 of query aligns to 9:242/353 of 1vciA
Q9BZC7 ATP-binding cassette sub-family A member 2; ATP-binding cassette transporter 2; ATP-binding cassette 2; EC 7.6.2.- from Homo sapiens (Human) (see paper)
32% identity, 80% coverage: 20:225/257 of query aligns to 1007:1205/2435 of Q9BZC7
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 87% coverage: 7:229/257 of query aligns to 5:224/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 88% coverage: 6:230/257 of query aligns to 5:227/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 88% coverage: 6:230/257 of query aligns to 5:227/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 88% coverage: 6:230/257 of query aligns to 5:227/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 88% coverage: 6:230/257 of query aligns to 5:227/242 of 2oljA
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
29% identity, 82% coverage: 20:231/257 of query aligns to 3826:4032/5034 of Q5SSE9
Sites not aligning to the query:
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
29% identity, 83% coverage: 20:232/257 of query aligns to 20:228/276 of Q5M243
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 87% coverage: 7:229/257 of query aligns to 4:224/240 of 4ymuJ
7m1qA Human abca4 structure in complex with n-ret-pe (see paper)
30% identity, 82% coverage: 23:233/257 of query aligns to 825:1028/1911 of 7m1qA
Sites not aligning to the query:
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
30% identity, 88% coverage: 4:228/257 of query aligns to 2:226/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 88% coverage: 4:228/257 of query aligns to 4:228/263 of 7d0aB
>GFF860 FitnessBrowser__Marino:GFF860
MPVFFDVSNLDVRIGDTTILQNLNLGFGEGEVTALLGHNGSGKSTLLKVLARQLAPSTGN
VRLLGKSFRSTGAREFARNVGYLPQHPPGTDGLTVRELVALGRYPWRGPLGRYNEEDHRL
ITRAIEDTGLGQFQHRSVDTLSGGERQRAWIAMLLAQQTRCLLLDEPISALDVKHQVETL
RLVHRLAEQRDLTVIVVLHDVDLAARFCDRLVALKSGQLVADGSPRDIMDSGILESIYGV
PMGVMERAPGQWVSYVH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory