SitesBLAST
Comparing GFF860 FitnessBrowser__Phaeo:GFF860 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00367 Glutamate dehydrogenase 1, mitochondrial; GDH 1; EC 1.4.1.3 from Homo sapiens (Human) (see 9 papers)
44% identity, 99% coverage: 6:476/476 of query aligns to 63:555/558 of P00367
- K147 (= K71) modified: N6-(2-hydroxyisobutyryl)lysine
- C172 (= C96) modified: ADP-ribosylcysteine
- S270 (≠ E193) to C: in HHF6; diminished sensitivity to GTP
- R274 (= R197) to C: in HHF6; diminished sensitivity to GTP; dbSNP:rs56275071
- R318 (≠ K241) to T: in HHF6; diminished sensitivity to GTP
- R322 (≠ E246) to C: in HHF6; diminished sensitivity to GTP; to H: in HHF6; diminished sensitivity to GTP; dbSNP:rs121909737
- S501 (≠ D422) mutation to A: Reduces activity and inhibition by GTP.
- H507 (≠ R428) to Y: in HHF6; abolishes inhibition by ATP; no effect on activation by ADP; Strongly reduces inhibition by GTP; dbSNP:rs121909730
- R516 (= R436) mutation to A: Abolishes activation by ADP.
Sites not aligning to the query:
- 1:53 modified: transit peptide, Mitochondrion
6dhdA Bovine glutamate dehydrogenase complexed with nadh, gtp, glutamate (see paper)
44% identity, 99% coverage: 6:476/476 of query aligns to 6:498/501 of 6dhdA
- active site: K126 (= K107), D168 (= D149)
- binding glutamic acid: K90 (= K71), M111 (= M92), K114 (= K95), K126 (= K107), A166 (= A147), V378 (= V361), S381 (= S364)
- binding guanosine-5'-triphosphate: H209 (≠ A189), S213 (≠ E193), R217 (= R197), H258 (= H238), R261 (≠ K241), Y262 (≠ F242), R265 (≠ E246), E292 (≠ F273), H450 (≠ R428)
- binding 1,4-dihydronicotinamide adenine dinucleotide: H85 (= H66), R86 (≠ M67), R94 (= R75), A116 (= A97), D119 (≠ E100), V120 (≠ A101), D168 (= D149), M169 (= M150), H195 (≠ K175), Q205 (≠ A185), G206 (= G186), T215 (= T195), Q250 (= Q230), F252 (≠ L232), G253 (= G233), N254 (= N234), V255 (= V235), E275 (= E256), S276 (≠ R257), A326 (= A309), A348 (= A331), N349 (= N332), N374 (= N357), K387 (= K370), N388 (= N371), H391 (= H374), S393 (≠ R376), K488 (= K466), R491 (≠ K469)
3etgA Glutamate dehydrogenase complexed with gw5074 (see paper)
44% identity, 99% coverage: 6:476/476 of query aligns to 6:498/501 of 3etgA
- active site: K126 (= K107), D168 (= D149)
- binding glutamic acid: K90 (= K71), M111 (= M92), K114 (= K95), A166 (= A147), V378 (= V361), S381 (= S364)
- binding guanosine-5'-triphosphate: H209 (≠ A189), G210 (= G190), S213 (≠ E193), R217 (= R197), R261 (≠ K241), R265 (≠ E246), E292 (≠ F273)
- binding (3E)-3-[(3,5-dibromo-4-hydroxyphenyl)methylidene]-5-iodo-1,3-dihydro-2H-indol-2-one: R146 (= R127), R147 (= R128), M150 (≠ Y131)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D168 (= D149), M169 (= M150), R211 (= R191), T215 (= T195), Q250 (= Q230), G253 (= G233), V255 (= V235), E275 (= E256), S276 (≠ R257), A326 (= A309), G347 (≠ A330), A348 (= A331), N349 (= N332), N374 (= N357)
3etdA Structure of glutamate dehydrogenase complexed with bithionol (see paper)
44% identity, 99% coverage: 6:476/476 of query aligns to 6:498/501 of 3etdA
- active site: K126 (= K107), D168 (= D149)
- binding 2,2'-sulfanediylbis(4,6-dichlorophenol): R146 (= R127), R146 (= R127), R147 (= R128), D181 (= D162), S185 (≠ R166)
- binding glutamic acid: K90 (= K71), G92 (= G73), M111 (= M92), K114 (= K95), K126 (= K107), A166 (= A147), S381 (= S364)
- binding guanosine-5'-triphosphate: H209 (≠ A189), G210 (= G190), I212 (≠ V192), R217 (= R197), R261 (≠ K241), R265 (≠ E246), E292 (≠ F273), H450 (≠ R428)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R94 (= R75), D168 (= D149), M169 (= M150), R211 (= R191), T215 (= T195), Q250 (= Q230), F252 (≠ L232), G253 (= G233), V255 (= V235), E275 (= E256), S276 (≠ R257), A326 (= A309), A348 (= A331), N349 (= N332), N374 (= N357)
6dhlA Bovine glutamate dehydrogenase complexed with epicatechin-3-gallate (ecg) (see paper)
44% identity, 99% coverage: 6:476/476 of query aligns to 1:493/496 of 6dhlA
- binding (2R,3S)-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,4-dihydro-2H-chromen-3-yl 3,4,5-trihydroxybenzoate: H80 (= H66), R81 (≠ M67), C110 (= C96), D114 (≠ E100), V115 (≠ A101), K382 (= K370), S388 (≠ R376), R391 (= R379), R454 (= R436), K483 (= K466)
3eteA Crystal structure of bovine glutamate dehydrogenase complexed with hexachlorophene (see paper)
44% identity, 99% coverage: 6:476/476 of query aligns to 3:495/495 of 3eteA
- active site: K123 (= K107), D165 (= D149)
- binding glutamic acid: K87 (= K71), G89 (= G73), M108 (= M92), K111 (= K95), K123 (= K107), A163 (= A147), R208 (= R191), V375 (= V361), S378 (= S364)
- binding guanosine-5'-triphosphate: I209 (≠ V192), S210 (≠ E193), R214 (= R197), H255 (= H238), R258 (≠ K241), Y259 (≠ F242), K443 (≠ L424), H447 (≠ R428)
- binding 2,2'-methanediylbis(3,4,6-trichlorophenol): T183 (vs. gap), I184 (≠ M167), Y187 (≠ T170)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R91 (= R75), K131 (≠ R115), D165 (= D149), M166 (= M150), R208 (= R191), F249 (≠ L232), G250 (= G233), V252 (= V235), E272 (= E256), S273 (≠ R257), A323 (= A309), A345 (= A331), N346 (= N332), N371 (= N357)
8ar7A Bovine glutamate dehydrogenase in ternary complex with the allosteric activators adp and leucine (see paper)
44% identity, 99% coverage: 6:476/476 of query aligns to 2:494/496 of 8ar7A
- binding adenosine-5'-diphosphate: H81 (= H66), A112 (= A97), D115 (≠ E100), V116 (≠ A101), H205 (≠ A189), K383 (= K370), S389 (≠ R376), R392 (= R379), R455 (= R436), K484 (= K466), V488 (≠ S470)
- binding potassium ion: I47 (≠ K33), I48 (= I34), K49 (≠ R35), P50 (≠ V36), C51 (= C37), N52 (= N38), H78 (= H63), S79 (= S64)
- binding leucine: G493 (= G475), V494 (≠ L476)
Sites not aligning to the query:
1nqtA Crystal structure of bovine glutamate dehydrogenase-adp complex (see paper)
44% identity, 99% coverage: 6:476/476 of query aligns to 1:493/496 of 1nqtA
6dhmA Bovine glutamate dehydrogenase complexed with zinc (see paper)
44% identity, 98% coverage: 6:471/476 of query aligns to 6:493/495 of 6dhmA
- binding glutamic acid: K90 (= K71), G92 (= G73), M111 (= M92), K114 (= K95), A166 (= A147), D168 (= D149), R211 (= R191), V378 (= V361), S381 (= S364)
- binding guanosine-5'-triphosphate: H209 (≠ A189), S213 (≠ E193), H258 (= H238), R261 (≠ K241), Y262 (≠ F242), R265 (≠ E246), K289 (≠ E270), E292 (≠ F273), K446 (≠ L424), H450 (≠ R428)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D168 (= D149), M169 (= M150), S170 (≠ G151), R211 (= R191), Q250 (= Q230), G251 (= G231), F252 (≠ L232), G253 (= G233), N254 (= N234), V255 (= V235), E275 (= E256), S276 (≠ R257), A326 (= A309), G347 (≠ A330), A348 (= A331), N349 (= N332), N374 (= N357)
- binding zinc ion: H209 (≠ A189), H450 (≠ R428)
P49448 Glutamate dehydrogenase 2, mitochondrial; GDH 2; EC 1.4.1.3 from Homo sapiens (Human) (see 2 papers)
43% identity, 99% coverage: 6:476/476 of query aligns to 63:555/558 of P49448
- C172 (= C96) modified: ADP-ribosylcysteine
Sites not aligning to the query:
- 1:53 modified: transit peptide, Mitochondrion
P00366 Glutamate dehydrogenase 1, mitochondrial; GDH 1; EC 1.4.1.3 from Bos taurus (Bovine) (see 4 papers)
43% identity, 99% coverage: 6:476/476 of query aligns to 63:555/558 of P00366
- K84 (vs. gap) modified: N6-acetyllysine; alternate; modified: N6-succinyllysine; alternate
- K90 (≠ P27) modified: N6-acetyllysine
- K110 (≠ R35) modified: N6-acetyllysine; alternate; modified: N6-succinyllysine; alternate
- QHR 141:143 (≠ EHM 65:67) binding
- K147 (= K71) binding
- K162 (≠ E86) modified: N6-acetyllysine; alternate; modified: N6-succinyllysine; alternate
- K171 (= K95) binding
- D176 (≠ E100) binding
- K183 (= K107) modified: N6-acetyllysine; alternate
- K191 (≠ R115) modified: N6-acetyllysine; alternate
- H252 (≠ K175) binding
- H266 (≠ A189) binding
- S270 (≠ E193) binding
- Y319 (≠ F242) binding
- R322 (≠ E246) binding
- K363 (≠ D287) modified: N6-acetyllysine; alternate; modified: N6-succinyllysine; alternate
- K365 (≠ R289) modified: N6-acetyllysine; alternate
- K386 (≠ G312) modified: N6-acetyllysine
- K399 (≠ R325) modified: N6-acetyllysine
- K415 (≠ E341) modified: N6-acetyllysine; alternate; modified: N6-succinyllysine; alternate
- S438 (= S364) binding
- N444 (≠ K370) binding
- S450 (≠ R376) binding
- K457 (≠ R383) modified: N6-acetyllysine; alternate; modified: N6-malonyllysine; alternate; modified: N6-succinyllysine; alternate
- K480 (= K405) modified: N6-acetyllysine; alternate
- K503 (≠ L424) modified: N6-acetyllysine; alternate; modified: N6-malonyllysine; alternate; modified: N6-succinyllysine; alternate
- R516 (= R436) binding
- K527 (≠ H447) modified: N6-acetyllysine; alternate; modified: N6-malonyllysine; alternate; modified: N6-succinyllysine; alternate
- K545 (= K466) modified: N6-acetyllysine; alternate; modified: N6-succinyllysine; alternate
Sites not aligning to the query:
- 1:57 modified: transit peptide, Mitochondrion
1hwyA Bovine glutamate dehydrogenase complexed with NAD and 2-oxoglutarate (see paper)
43% identity, 99% coverage: 6:476/476 of query aligns to 6:498/501 of 1hwyA
- active site: K126 (= K107), N168 (≠ D149)
- binding 2-oxoglutaric acid: K90 (= K71), M111 (= M92), K114 (= K95), A166 (= A147), R211 (= R191), V378 (= V361), S381 (= S364)
- binding nicotinamide-adenine-dinucleotide: R86 (≠ M67), T87 (≠ E68), C115 (= C96), A116 (= A97), D119 (≠ E100), V120 (≠ A101), P121 (= P102), N168 (≠ D149), M169 (= M150), H195 (≠ K175), Q205 (≠ A185), G206 (= G186), T215 (= T195), G251 (= G231), F252 (≠ L232), G253 (= G233), N254 (= N234), V255 (= V235), E275 (= E256), S276 (≠ R257), A326 (= A309), A348 (= A331), N349 (= N332), N374 (= N357), K387 (= K370), H391 (= H374), V392 (≠ I375), S393 (≠ R376), K488 (= K466)
6yehA Arabidopsis thaliana glutamate dehydrogenase isoform 1 in apo form (see paper)
46% identity, 75% coverage: 17:372/476 of query aligns to 10:351/410 of 6yehA
P80053 Glutamate dehydrogenase 2; GDH-2; EC 1.4.1.3 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
38% identity, 91% coverage: 43:476/476 of query aligns to 42:419/420 of P80053
- K254 (≠ N265) modified: N6-methyllysine
- K260 (≠ A271) modified: N6-methyllysine
- K372 (≠ H389) modified: N6-methyllysine
- K391 (≠ G448) modified: N6-methyllysine
- K392 (≠ R449) modified: N6-methyllysine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylmethionine
6yeiA Arabidopsis thaliana glutamate dehydrogenase isoform 1 in complex with NAD (see paper)
46% identity, 75% coverage: 17:372/476 of query aligns to 10:351/409 of 6yeiA
- binding potassium ion: S26 (≠ K33), L27 (≠ I34), I29 (≠ V36), P30 (≠ C37)
- binding nicotinamide-adenine-dinucleotide: T184 (= T195), F213 (≠ L232), G214 (= G233), N215 (= N234), V216 (= V235), D236 (≠ E256), I237 (≠ R257), A288 (= A309), L289 (= L310), A310 (= A331), N311 (= N332), N336 (= N357)
6yeiF Arabidopsis thaliana glutamate dehydrogenase isoform 1 in complex with NAD (see paper)
46% identity, 75% coverage: 17:372/476 of query aligns to 11:352/410 of 6yeiF
- binding 2-oxoglutaric acid: K66 (= K71), G68 (= G73), M87 (= M92), K90 (= K95), K102 (= K107), A140 (= A147), V341 (= V361), S344 (= S364)
- binding potassium ion: S27 (≠ K33), L28 (≠ I34), I30 (≠ V36), P31 (≠ C37), F32 (≠ N38)
- binding nicotinamide-adenine-dinucleotide: R70 (= R75), D142 (= D149), M143 (= M150), T185 (= T195), F214 (≠ L232), G215 (= G233), N216 (= N234), V217 (= V235), D237 (≠ E256), I238 (≠ R257), A288 (= A308), A289 (= A309), A311 (= A331), N312 (= N332), N337 (= N357)
8xd5A Cryo-em structure of glutamate dehydrogenase from thermococcus profundus in complex with NADP and glu in the steady stage of reaction
35% identity, 96% coverage: 17:475/476 of query aligns to 14:415/419 of 8xd5A
- binding gamma-l-glutamic acid: K69 (= K71), M90 (= M92), K105 (= K107), A143 (= A147), D145 (= D149), S351 (= S364)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R73 (= R75), D145 (= D149), V146 (≠ M150), Y147 (≠ G151), T191 (= T195), Y220 (≠ L232), G221 (= G233), N222 (= N234), A223 (≠ V235), D244 (≠ E256), S245 (≠ R257), K264 (≠ I276), N281 (= N293), A295 (= A308), A296 (= A309), I297 (≠ L310), N319 (= N332), N344 (= N357)
8xcoA Cryo-em structure of glutamate dehydrogenase from thermococcus profundus incorporating NADPH in the initial stage of reaction
35% identity, 96% coverage: 17:475/476 of query aligns to 11:412/416 of 8xcoA
P39633 Catabolic NAD-specific glutamate dehydrogenase RocG; NAD-GDH; Glutamate dehydrogenase; GlutDH; Trigger enzyme RocG; EC 1.4.1.2 from Bacillus subtilis (strain 168) (see 2 papers)
40% identity, 76% coverage: 12:371/476 of query aligns to 20:365/424 of P39633
- E27 (≠ R19) mutation to F: Increase of thermostability 8 degrees Celsius higher than that of the wild-type.
- E93 (= E84) mutation to K: Reduces the affinity for glutamate and ammonium.
- D122 (= D113) mutation to N: Unable to control gltAB expression via an inhibitory interactions with the transcriptional regulator GltC. Reduces the affinity for glutamate and ammonium.
- Q144 (≠ D137) mutation to R: Increase of thermostability 20 degrees Celsius higher than that of the wild-type.
- Y158 (≠ G151) mutation to H: Reduces the affinity for glutamate and ammonium.
- S234 (≠ Y237) mutation to R: Reduces the affinity for glutamate and ammonium.
- A324 (= A330) mutation to R: No effect.
8xcsA Cryo-em structure of glutamate dehydrogenase from thermococcus profundus in complex with NADPH, akg and nh4 in the initial stage of reaction
35% identity, 96% coverage: 17:475/476 of query aligns to 13:414/418 of 8xcsA
- binding 2-oxoglutaric acid: K68 (= K71), G70 (= G73), M89 (= M92), K92 (= K95), K104 (= K107), A142 (= A147), D144 (= D149), G346 (= G360), S350 (= S364)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R72 (= R75), K112 (≠ R115), P143 (= P148), D144 (= D149), V145 (≠ M150), Y146 (≠ G151), T190 (= T195), Y219 (≠ L232), G220 (= G233), N221 (= N234), A222 (≠ V235), D243 (≠ E256), S244 (≠ R257), K263 (≠ I276), A295 (= A309), I296 (≠ L310), N318 (= N332)
Query Sequence
>GFF860 FitnessBrowser__Phaeo:GFF860
MSSATEPSFRQSVDLMFNRAVSLMDLPPGLEEKIRVCNATYTVRFGVRLRGGIQTFTGYR
SVHSEHMEPVKGGIRYAMGVNQDEVEALAALMTYKCALVEAPFGGSKGGLCIDPRQYEEH
ELELITRRFAYELAKRDLINPSQNVPAPDMGTGEREMAWIADQYARMNTTDINAKACVTG
KPLNAGGIAGRVEATGRGVQYALREFFRNPEDVAAANMDGKLDGKRVIVQGLGNVGYHAA
KFLMSEDGAKITAVIERDGGLIDENGLDIEAVFQWIANNGGVTGYPDARYVENGALLLEE
DCDILIPAALEGVINLTNAANIKARLIIEAANGPVTAGADEILRDKGTVIIPDMYANAGG
VTVSYFEWVKNLSHIRFGRMQRRQEEARHQLVVDELEALSESLGKTWTLNPKFTERYLRG
ADELELVRSGLDDTMRTAYQSMREVWHGRNDVTDLRTAAYLVSIDKVAKSYRAKGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory