Comparing GFF891 FitnessBrowser__Phaeo:GFF891 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59954 Adenylyltransferase and sulfurtransferase uba4; Common component for nitrate reductase and xanthine dehydrogenase protein F; Ubiquitin-like protein activator 4; EC 2.7.7.80; EC 2.8.1.11 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
44% identity, 61% coverage: 10:209/329 of query aligns to 68:278/482 of O59954
Q9VLJ8 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Ubiquitin activating enzyme 4; EC 2.7.7.80; EC 2.8.1.11 from Drosophila melanogaster (Fruit fly) (see paper)
39% identity, 66% coverage: 8:224/329 of query aligns to 69:288/453 of Q9VLJ8
Sites not aligning to the query:
6yubB Crystal structure of uba4 from chaetomium thermophilum (see paper)
40% identity, 65% coverage: 8:222/329 of query aligns to 12:227/289 of 6yubB
Sites not aligning to the query:
6yubA Crystal structure of uba4 from chaetomium thermophilum (see paper)
39% identity, 65% coverage: 8:222/329 of query aligns to 11:228/423 of 6yubA
Sites not aligning to the query:
P38820 Adenylyltransferase and sulfurtransferase UBA4; Needs CLA4 to survive protein 3; Ubiquitin-like protein activator 4; EC 2.7.7.-; EC 2.8.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 4 papers)
36% identity, 63% coverage: 5:210/329 of query aligns to 41:251/440 of P38820
Sites not aligning to the query:
P12282 Molybdopterin-synthase adenylyltransferase; MoaD protein adenylase; Molybdopterin-converting factor subunit 1 adenylase; Sulfur carrier protein MoaD adenylyltransferase; EC 2.7.7.80 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 66% coverage: 8:224/329 of query aligns to 9:227/249 of P12282
Sites not aligning to the query:
O95396 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Molybdopterin synthase sulfurylase; MPT synthase sulfurylase; EC 2.7.7.80; EC 2.8.1.11 from Homo sapiens (Human) (see 5 papers)
39% identity, 65% coverage: 10:224/329 of query aligns to 62:279/460 of O95396
Sites not aligning to the query:
Q72J02 Sulfur carrier protein adenylyltransferase; E1-like protein TtuC; Sulfur carrier protein MoaD adenylyltransferase; Sulfur carrier protein ThiS adenylyltransferase; Sulfur carrier protein TtuB adenylyltransferase; tRNA two-thiouridine-synthesizing protein C; EC 2.7.7.80; EC 2.7.7.73; EC 2.7.7.- from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
43% identity, 62% coverage: 8:210/329 of query aligns to 8:218/271 of Q72J02
Sites not aligning to the query:
D4GSF3 SAMP-activating enzyme E1; Ubiquitin-like activating enzyme of archaea; Ubl-activating enzyme; EC 2.7.7.- from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii) (see paper)
35% identity, 77% coverage: 8:259/329 of query aligns to 10:262/270 of D4GSF3
1jwbB Structure of the covalent acyl-adenylate form of the moeb-moad protein complex (see paper)
36% identity, 66% coverage: 8:224/329 of query aligns to 8:219/240 of 1jwbB
Sites not aligning to the query:
1jw9B Structure of the native moeb-moad protein complex (see paper)
36% identity, 66% coverage: 8:224/329 of query aligns to 8:219/240 of 1jw9B
Sites not aligning to the query:
1jwaB Structure of the atp-bound moeb-moad protein complex (see paper)
35% identity, 66% coverage: 8:224/329 of query aligns to 8:204/217 of 1jwaB
1zfnA Structural analysis of escherichia coli thif (see paper)
37% identity, 67% coverage: 6:224/329 of query aligns to 4:223/244 of 1zfnA
Sites not aligning to the query:
P30138 Sulfur carrier protein ThiS adenylyltransferase; EC 2.7.7.73 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 67% coverage: 6:224/329 of query aligns to 4:223/251 of P30138
Sites not aligning to the query:
1zud3 Structure of this-thif protein complex (see paper)
37% identity, 48% coverage: 6:163/329 of query aligns to 4:161/240 of 1zud3
Sites not aligning to the query:
6nyaA Crystal structure of ubiquitin e1 (uba1) in complex with ubc3 (cdc34) and ubiquitin (see paper)
29% identity, 60% coverage: 9:204/329 of query aligns to 405:609/987 of 6nyaA
Sites not aligning to the query:
5tr4A Structure of ubiquitin activating enzyme (uba1) in complex with ubiquitin and tak-243
30% identity, 60% coverage: 9:204/329 of query aligns to 402:606/972 of 5tr4A
Sites not aligning to the query:
7k5jI Structure of an e1-e2-ubiquitin thioester mimetic (see paper)
31% identity, 47% coverage: 9:162/329 of query aligns to 404:566/979 of 7k5jI
Sites not aligning to the query:
5l6jA Uba1 in complex with ub-mln7243 covalent adduct (see paper)
30% identity, 52% coverage: 9:178/329 of query aligns to 404:582/1006 of 5l6jA
Sites not aligning to the query:
5l6iA Uba1 in complex with ub-mln4924 covalent adduct (see paper)
30% identity, 52% coverage: 9:178/329 of query aligns to 406:584/1007 of 5l6iA
Sites not aligning to the query:
>GFF891 FitnessBrowser__Phaeo:GFF891
MDQGLRLMSRFDRQIALPEVGAEGQAKLAAAHVLVVGAGGLGSPVLQYLAGAGIGEITVM
DGDSVEATNLPRQPLYTPADIGRYKVDAARERLCAMAPELRLHPHARDLTPDNVMAAVTP
VDLVIDAADSHAVSYTLSDCCQRLGRDLISGSALAQSGYVGVFCGGGPSLRAVFPDPPGS
AATCATSGIMGPVVGVIGAWQAQLALKLLLNHQPTPRGRIFSVDFAGLQMGGFDFSTARE
PARPLPFIGLNAITDEDYVVELRPEQEAPTPAIRTAVRILPEALQARDLPSDRRVVLACH
SGLRAWRTAAEIAPDFAGELVLLAAGQPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory