SitesBLAST
Comparing GFF901 FitnessBrowser__Marino:GFF901 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3gegA Fingerprint and structural analysis of a scor enzyme with its bound cofactor from clostridium thermocellum (see paper)
43% identity, 99% coverage: 1:241/243 of query aligns to 6:230/241 of 3gegA
- active site: S132 (= S130), Y145 (= Y143), K149 (= K147)
- binding nicotinamide-adenine-dinucleotide: G8 (= G3), H11 (≠ K6), I13 (= I8), D32 (= D27), I33 (≠ T28), R37 (≠ A38), D54 (= D50), V55 (= V51), N81 (= N77), C83 (≠ A81), R84 (≠ N82), I130 (≠ M128), A131 (= A129), S132 (= S130), Y145 (= Y143), K149 (= K147), P174 (= P172), G175 (= G173), I177 (= I175), V179 (≠ T177)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
38% identity, 96% coverage: 1:234/243 of query aligns to 12:251/255 of 5itvA
- active site: G18 (= G7), S141 (= S130), Y154 (= Y143), K158 (= K147)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G3), S17 (≠ K6), G18 (= G7), I19 (= I8), D38 (= D27), I39 (≠ T28), T61 (≠ G49), I63 (≠ V51), N89 (= N77), G91 (= G79), T139 (≠ M128), S141 (= S130), Y154 (= Y143), K158 (= K147), P184 (= P172), G185 (= G173), I186 (≠ W174), I187 (= I175)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
41% identity, 97% coverage: 1:235/243 of query aligns to 10:236/240 of 2d1yA
- active site: G16 (= G7), S135 (= S130), N145 (≠ T140), Y148 (= Y143), K152 (= K147)
- binding nicotinamide-adenine-dinucleotide: G12 (= G3), R15 (≠ K6), I17 (= I8), D36 (= D27), L37 (≠ T28), R38 (≠ D29), V55 (≠ G49), D56 (= D50), L57 (≠ V51), N83 (= N77), A84 (= A78), A85 (≠ G79), I86 (= I80), V133 (≠ M128), S135 (= S130), Y148 (= Y143), K152 (= K147), P178 (= P172), G179 (= G173), I181 (= I175), T183 (= T177), A185 (= A179), V186 (≠ W180)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
38% identity, 96% coverage: 1:234/243 of query aligns to 12:223/227 of 5itvD
- active site: G18 (= G7), S141 (= S130), Y154 (= Y143), K158 (= K147)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G3), S17 (≠ K6), G18 (= G7), I19 (= I8), D38 (= D27), I39 (≠ T28), T61 (≠ G49), D62 (= D50), I63 (≠ V51), N89 (= N77), T139 (≠ M128), S141 (= S130), Y154 (= Y143), K158 (= K147), P184 (= P172), G185 (= G173), I187 (= I175)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
36% identity, 98% coverage: 1:237/243 of query aligns to 18:258/267 of 3ay6B
- active site: G24 (= G7), S151 (= S130), Y164 (= Y143), K168 (= K147)
- binding beta-D-glucopyranose: E102 (≠ A81), S151 (= S130), H153 (≠ R132), W158 (≠ E137), Y164 (= Y143), N202 (vs. gap), K205 (≠ G182)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G3), T23 (≠ K6), G24 (= G7), L25 (≠ I8), Y45 (≠ T28), D71 (= D50), V72 (= V51), N98 (= N77), A99 (= A78), G100 (= G79), V101 (≠ I80), M149 (= M128), S151 (= S130), Y164 (= Y143), K168 (= K147), P194 (= P172), G195 (= G173), M197 (≠ I175), T199 (= T177), P200 (≠ R178), I201 (≠ A179), N202 (vs. gap)
6zt2A 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with 3-chloro-2,6-difluorophenol
39% identity, 89% coverage: 19:234/243 of query aligns to 28:244/252 of 6zt2A
- binding beta-D-glucopyranose: W184 (≠ D176), T185 (= T177), P186 (≠ R178), E189 (≠ Q181)
- binding nicotinamide-adenine-dinucleotide: D36 (= D27), K37 (≠ T28), D58 (= D50), V59 (= V51), N85 (= N77), L109 (≠ V102), S137 (= S130), Y150 (= Y143), K154 (= K147), P180 (= P172), G181 (= G173), N182 (≠ W174), I183 (= I175), T185 (= T177), L187 (≠ A179)
- binding 3-chloranyl-2,6-bis(fluoranyl)phenol: H89 (≠ A81), S137 (= S130), Y150 (= Y143), N182 (≠ W174), W188 (= W180)
Sites not aligning to the query:
6zdiA 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with 2-fluoro-5-nitrophenol
39% identity, 89% coverage: 19:234/243 of query aligns to 28:244/252 of 6zdiA
- active site: S137 (= S130), Y150 (= Y143), K154 (= K147)
- binding nicotinamide-adenine-dinucleotide: D36 (= D27), K37 (≠ T28), D58 (= D50), V59 (= V51), N85 (= N77), A86 (= A78), L109 (≠ V102), I135 (≠ M128), S137 (= S130), Y150 (= Y143), K154 (= K147), P180 (= P172), G181 (= G173), N182 (≠ W174), I183 (= I175), T185 (= T177), L187 (≠ A179)
- binding 2-fluoranyl-5-nitro-phenol: H89 (≠ A81), S137 (= S130), Y150 (= Y143), L187 (≠ A179), W188 (= W180), L191 (≠ G183)
Sites not aligning to the query:
6zdeA 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with pentafluorophenol
39% identity, 89% coverage: 19:234/243 of query aligns to 28:244/252 of 6zdeA
- active site: S137 (= S130), Y150 (= Y143), K154 (= K147)
- binding nicotinamide-adenine-dinucleotide: D36 (= D27), K37 (≠ T28), D58 (= D50), V59 (= V51), N85 (= N77), L109 (≠ V102), S137 (= S130), Y150 (= Y143), K154 (= K147), P180 (= P172), G181 (= G173), N182 (≠ W174), I183 (= I175), T185 (= T177), L187 (≠ A179)
- binding 2,3,4,5,6-pentakis(fluoranyl)phenol: H89 (≠ A81), S137 (= S130), Y150 (= Y143), L187 (≠ A179), W188 (= W180)
Sites not aligning to the query:
6qckA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fb262 (see paper)
39% identity, 89% coverage: 19:234/243 of query aligns to 29:245/258 of 6qckA
- active site: S138 (= S130), Y151 (= Y143), K155 (= K147)
- binding beta-D-glucopyranose: W185 (≠ D176), T186 (= T177), P187 (≠ R178), E190 (≠ Q181)
- binding 2-[2-(1,3-benzodioxol-2-yl)ethyl]benzoic acid: H90 (≠ A81), P93 (≠ E84), S138 (= S130), Q145 (≠ E137), Y151 (= Y143), L188 (≠ A179), W189 (= W180), L192 (≠ G183)
- binding nicotinamide-adenine-dinucleotide: D37 (= D27), K38 (≠ T28), D59 (= D50), V60 (= V51), N86 (= N77), L110 (≠ V102), S138 (= S130), Y151 (= Y143), K155 (= K147), P181 (= P172), G182 (= G173), N183 (≠ W174), I184 (= I175), T186 (= T177), L188 (≠ A179)
Sites not aligning to the query:
5hs6A Human 17beta-hydroxysteroid dehydrogenase type 14 in complex with estrone (see paper)
39% identity, 89% coverage: 19:234/243 of query aligns to 29:245/257 of 5hs6A
- active site: S138 (= S130), A148 (≠ T140), Y151 (= Y143), K155 (= K147)
- binding (9beta,13alpha)-3-hydroxyestra-1,3,5(10)-trien-17-one: H90 (≠ A81), Q145 (≠ E137), Y151 (= Y143), L192 (≠ G183)
- binding nicotinamide-adenine-dinucleotide: D37 (= D27), K38 (≠ T28), D59 (= D50), N86 (= N77), L110 (≠ V102), S138 (= S130), Y151 (= Y143), K155 (= K147), P181 (= P172), G182 (= G173), N183 (≠ W174), I184 (= I175), T186 (= T177), L188 (≠ A179)
Sites not aligning to the query:
5en4A Complex of 17-beta-hydroxysteroid dehydrogenase type 14 with inhibitor. (see paper)
39% identity, 89% coverage: 19:234/243 of query aligns to 29:245/251 of 5en4A
- active site: S138 (= S130), A148 (≠ T140), Y151 (= Y143), K155 (= K147)
- binding [2,3-bis(oxidanyl)phenyl]-[6-(2-fluoranyl-3-oxidanyl-phenyl)pyridin-2-yl]methanone: H90 (≠ A81), S138 (= S130), Q145 (≠ E137), A146 (≠ P138), Q147 (≠ D139), Y151 (= Y143), N183 (≠ W174), W189 (= W180), L192 (≠ G183)
- binding nicotinamide-adenine-dinucleotide: D37 (= D27), K38 (≠ T28), D59 (= D50), V60 (= V51), N86 (= N77), L110 (≠ V102), S138 (= S130), Y151 (= Y143), K155 (= K147), P181 (= P172), G182 (= G173), I184 (= I175), T186 (= T177), L188 (≠ A179)
Sites not aligning to the query:
5o6oA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal 2,6-pyridinketone inhibitor (see paper)
39% identity, 89% coverage: 19:234/243 of query aligns to 29:245/256 of 5o6oA
- active site: S138 (= S130), Y151 (= Y143), K155 (= K147)
- binding 2-fluoranyl-3-[6-(4-fluoranyl-3-oxidanyl-phenoxy)pyridin-2-yl]phenol: H90 (≠ A81), S138 (= S130), Q145 (≠ E137), A146 (≠ P138), Q147 (≠ D139), Y151 (= Y143), N183 (≠ W174), W189 (= W180), L192 (≠ G183)
- binding beta-D-glucopyranose: W185 (≠ D176), T186 (= T177), P187 (≠ R178), E190 (≠ Q181)
- binding nicotinamide-adenine-dinucleotide: D37 (= D27), K38 (≠ T28), D59 (= D50), V60 (= V51), N86 (= N77), L110 (≠ V102), S138 (= S130), Y151 (= Y143), K155 (= K147), P181 (= P172), G182 (= G173), N183 (≠ W174), I184 (= I175), T186 (= T177), L188 (≠ A179)
Sites not aligning to the query:
5o43A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal 2,6-pyridinketone inhibitor. (see paper)
39% identity, 89% coverage: 19:234/243 of query aligns to 29:245/253 of 5o43A
- active site: S138 (= S130), Y151 (= Y143), K155 (= K147)
- binding 2-fluoranyl-3-[6-[(4-fluoranyl-3-oxidanyl-phenyl)-methyl-amino]pyridin-2-yl]phenol: H90 (≠ A81), S138 (= S130), Q145 (≠ E137), A146 (≠ P138), Q147 (≠ D139), Y151 (= Y143), N183 (≠ W174), W189 (= W180), L192 (≠ G183)
- binding beta-D-glucopyranose: W185 (≠ D176), T186 (= T177), P187 (≠ R178), E190 (≠ Q181)
- binding nicotinamide-adenine-dinucleotide: D37 (= D27), K38 (≠ T28), D59 (= D50), V60 (= V51), N86 (= N77), L110 (≠ V102), Y151 (= Y143), K155 (= K147), P181 (= P172), G182 (= G173), N183 (≠ W174), I184 (= I175), T186 (= T177), L188 (≠ A179)
Sites not aligning to the query:
5o42A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal 2,6-pyridinketone inhibitor. (see paper)
39% identity, 89% coverage: 19:234/243 of query aligns to 29:245/256 of 5o42A
- active site: S138 (= S130), Y151 (= Y143), K155 (= K147)
- binding 2-fluoranyl-3-[6-[1-(4-fluoranyl-3-oxidanyl-phenyl)ethenyl]pyridin-2-yl]phenol: H90 (≠ A81), P93 (≠ E84), S138 (= S130), Q145 (≠ E137), A146 (≠ P138), Y151 (= Y143), N183 (≠ W174), W189 (= W180), L192 (≠ G183)
- binding beta-D-glucopyranose: W185 (≠ D176), T186 (= T177), P187 (≠ R178), E190 (≠ Q181)
- binding nicotinamide-adenine-dinucleotide: D37 (= D27), K38 (≠ T28), D59 (= D50), V60 (= V51), N86 (= N77), G88 (= G79), L110 (≠ V102), S138 (= S130), Y151 (= Y143), K155 (= K147), P181 (= P172), G182 (= G173), N183 (≠ W174), I184 (= I175), T186 (= T177), L188 (≠ A179)
Sites not aligning to the query:
5o72A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal quinoline based inhibitor (see paper)
39% identity, 89% coverage: 19:234/243 of query aligns to 28:244/255 of 5o72A
- active site: S137 (= S130), Y150 (= Y143), K154 (= K147)
- binding 2-azanyl-~{N}-[2-(4-fluoranyl-3-oxidanyl-phenyl)carbonylquinolin-7-yl]ethanamide: H89 (≠ A81), S137 (= S130), Y150 (= Y143), N182 (≠ W174), W188 (= W180), L191 (≠ G183)
- binding nicotinamide-adenine-dinucleotide: D36 (= D27), K37 (≠ T28), D58 (= D50), V59 (= V51), N85 (= N77), L109 (≠ V102), Y150 (= Y143), K154 (= K147), P180 (= P172), G181 (= G173), N182 (≠ W174), I183 (= I175), T185 (= T177), L187 (≠ A179)
Sites not aligning to the query:
5l7yA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal inhibitor. (see paper)
39% identity, 89% coverage: 19:234/243 of query aligns to 29:245/256 of 5l7yA
- active site: S138 (= S130), A148 (≠ T140), Y151 (= Y143), K155 (= K147)
- binding (4-fluoranyl-3-oxidanyl-phenyl)-[6-(2-fluoranyl-3-oxidanyl-phenyl)pyridin-2-yl]methanone: G42 (≠ V32), A45 (≠ R35), H90 (≠ A81), S138 (= S130), Q145 (≠ E137), A146 (≠ P138), Y151 (= Y143), N183 (≠ W174), W189 (= W180), L192 (≠ G183)
- binding nicotinamide-adenine-dinucleotide: D37 (= D27), K38 (≠ T28), D59 (= D50), V60 (= V51), N86 (= N77), L110 (≠ V102), I136 (≠ M128), Y151 (= Y143), K155 (= K147), P181 (= P172), G182 (= G173), I184 (= I175), T186 (= T177), L188 (≠ A179)
Sites not aligning to the query:
5l7tA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal inhibitor. (see paper)
39% identity, 89% coverage: 19:234/243 of query aligns to 29:245/256 of 5l7tA
- active site: S138 (= S130), A148 (≠ T140), Y151 (= Y143), K155 (= K147)
- binding (4-fluoranyl-3-oxidanyl-phenyl)-[6-(3-methyl-4-oxidanyl-phenyl)pyridin-2-yl]methanone: H90 (≠ A81), S138 (= S130), Q145 (≠ E137), A146 (≠ P138), Y151 (= Y143), N183 (≠ W174), W189 (= W180), L192 (≠ G183)
- binding nicotinamide-adenine-dinucleotide: D37 (= D27), K38 (≠ T28), D59 (= D50), V60 (= V51), N86 (= N77), A87 (= A78), G88 (= G79), L110 (≠ V102), S138 (= S130), Y151 (= Y143), K155 (= K147), P181 (= P172), G182 (= G173), N183 (≠ W174), I184 (= I175), T186 (= T177), L188 (≠ A179)
Sites not aligning to the query:
5l7wA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal inhibitor. (see paper)
39% identity, 89% coverage: 19:234/243 of query aligns to 29:245/254 of 5l7wA
- active site: S138 (= S130), A148 (≠ T140), Y151 (= Y143), K155 (= K147)
- binding [4-fluoranyl-2,3-bis(oxidanyl)phenyl]-[6-(2-fluoranyl-3-oxidanyl-phenyl)pyridin-2-yl]methanone: H90 (≠ A81), S138 (= S130), Q145 (≠ E137), A146 (≠ P138), Q147 (≠ D139), Y151 (= Y143), N183 (≠ W174), W189 (= W180), L192 (≠ G183)
- binding beta-D-glucopyranose: W185 (≠ D176), T186 (= T177), P187 (≠ R178), E190 (≠ Q181)
- binding nicotinamide-adenine-dinucleotide: D37 (= D27), K38 (≠ T28), D59 (= D50), V60 (= V51), N86 (= N77), A87 (= A78), G88 (= G79), L110 (≠ V102), S138 (= S130), Y151 (= Y143), K155 (= K147), P181 (= P172), G182 (= G173), N183 (≠ W174), I184 (= I175), T186 (= T177), L188 (≠ A179)
Sites not aligning to the query:
6gtbA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fb211
39% identity, 89% coverage: 19:234/243 of query aligns to 29:245/257 of 6gtbA
- active site: S138 (= S130), Y151 (= Y143), K155 (= K147)
- binding beta-D-glucopyranose: W185 (≠ D176), T186 (= T177), P187 (≠ R178), E190 (≠ Q181)
- binding 3-[6-(3-hydroxyphenyl)pyridin-2-yl]benzoic acid: H90 (≠ A81), P93 (≠ E84), S138 (= S130), Q145 (≠ E137), A146 (≠ P138), Q147 (≠ D139), Y151 (= Y143), W189 (= W180), L192 (≠ G183), M196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: D37 (= D27), K38 (≠ T28), D59 (= D50), V60 (= V51), N86 (= N77), L110 (≠ V102), S138 (= S130), Y151 (= Y143), K155 (= K147), P181 (= P172), G182 (= G173), N183 (≠ W174), I184 (= I175), T186 (= T177), L188 (≠ A179)
Sites not aligning to the query:
5o7cA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal quinoline based inhibitor (see paper)
39% identity, 89% coverage: 19:234/243 of query aligns to 29:245/257 of 5o7cA
- active site: S138 (= S130), Y151 (= Y143), K155 (= K147)
- binding 2-(4-fluoranyl-3-oxidanyl-phenyl)carbonylquinoline-7-carbonitrile: H90 (≠ A81), P93 (≠ E84), S138 (= S130), Y151 (= Y143), N183 (≠ W174), W189 (= W180), L192 (≠ G183), T202 (≠ P189)
- binding beta-D-glucopyranose: W185 (≠ D176), T186 (= T177), P187 (≠ R178), E190 (≠ Q181)
- binding nicotinamide-adenine-dinucleotide: D37 (= D27), K38 (≠ T28), D59 (= D50), V60 (= V51), N86 (= N77), A87 (= A78), L110 (≠ V102), S138 (= S130), Y151 (= Y143), K155 (= K147), P181 (= P172), G182 (= G173), N183 (≠ W174), I184 (= I175), T186 (= T177), L188 (≠ A179)
Sites not aligning to the query:
Query Sequence
>GFF901 FitnessBrowser__Marino:GFF901
MTGGAKGIGRGIVLHLAAAGWKVAFCDTDSAVGERLAAGADYALHFLPGDVASETDVERI
VAEALRWGGRLDAVINNAGIANPETGPIEELSLDQWQRRLDVNLTGPFLVTKHAVPHLRK
TKGAIVNMASTRALQSEPDTEAYAATKGGIVALTHALAVSLGPDVRVNCISPGWIDTRAW
QGGAEPVEPLSENDHLQHPAGRVGQPGDIASLVAYLISQEASFITGQNFVADGGMVRKMI
YEE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory