Comparing GFF907 FitnessBrowser__Phaeo:GFF907 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
47% identity, 86% coverage: 1:90/105 of query aligns to 115:203/204 of 7bgnA
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
46% identity, 86% coverage: 1:90/105 of query aligns to 125:212/213 of 7bgmA
Sites not aligning to the query:
6j2lA Crystal structure of bi-functional enzyme (see paper)
41% identity, 63% coverage: 3:68/105 of query aligns to 113:178/200 of 6j2lA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
33% identity, 63% coverage: 3:68/105 of query aligns to 106:163/185 of 6j2lB
Sites not aligning to the query:
>GFF907 FitnessBrowser__Phaeo:GFF907
MTLLHDLETTILSRKGADPDSSWTAKLLAKGPEKCAEKFGEEAIEAIIEAVKDNKTGLAS
EGADVLYHFLVMLAARDVALDDVLQVLADRQGLSGIAEKAARPKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory