Comparing GFF919 FitnessBrowser__Phaeo:GFF919 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
48% identity, 98% coverage: 5:446/450 of query aligns to 12:453/453 of 6g4dB
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
49% identity, 96% coverage: 5:436/450 of query aligns to 12:443/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
49% identity, 96% coverage: 5:436/450 of query aligns to 12:443/451 of 6g4eA
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
47% identity, 94% coverage: 22:442/450 of query aligns to 40:460/460 of 5kr6B
5ghgB Transaminase w58l with smba
47% identity, 93% coverage: 17:436/450 of query aligns to 28:425/433 of 5ghgB
Sites not aligning to the query:
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
44% identity, 95% coverage: 15:443/450 of query aligns to 69:496/504 of Q94CE5
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
46% identity, 92% coverage: 22:436/450 of query aligns to 36:450/455 of 5kr5A
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
45% identity, 92% coverage: 24:436/450 of query aligns to 40:452/459 of 5kquC
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
45% identity, 94% coverage: 22:442/450 of query aligns to 39:457/458 of 5kr3A
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
42% identity, 96% coverage: 15:444/450 of query aligns to 26:456/459 of D6R3B6
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
40% identity, 97% coverage: 5:442/450 of query aligns to 15:449/450 of 6gwiB
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
40% identity, 93% coverage: 22:439/450 of query aligns to 40:457/458 of 3gjuA
Sites not aligning to the query:
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
41% identity, 95% coverage: 19:444/450 of query aligns to 33:453/454 of 7ypmA
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
39% identity, 94% coverage: 19:442/450 of query aligns to 4:421/422 of 7qx3A
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
40% identity, 95% coverage: 19:444/450 of query aligns to 33:453/455 of 7ypnD
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
38% identity, 93% coverage: 18:437/450 of query aligns to 35:455/458 of 3fcrA
Sites not aligning to the query:
4grxC Structure of an omega-aminotransferase from paracoccus denitrificans (see paper)
37% identity, 97% coverage: 5:442/450 of query aligns to 12:448/449 of 4grxC
4e3qA Pmp-bound form of aminotransferase crystal structure from vibrio fluvialis (see paper)
38% identity, 95% coverage: 17:442/450 of query aligns to 30:451/452 of 4e3qA
Sites not aligning to the query:
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
38% identity, 96% coverage: 5:436/450 of query aligns to 17:444/448 of 6io1B
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
38% identity, 94% coverage: 19:442/450 of query aligns to 31:442/443 of 7qx0B
>GFF919 FitnessBrowser__Phaeo:GFF919
MAPVIYPTTNFTATEQLCLERGEGIYVFDSDGRKYIEGLAGLWCTSLGYSNTEVMDAITE
QLHKLPFTHTFGGKTHQPIQDLADKLAAMVPVEDAYIFFGNSGSDANDTHYKMLRYYFNA
IGKPEKRKIITRERGYHGVTVAAGSLTSLPANLAHFDAPLEALSILRADSPHYYTARQGN
ETEAQFVERILQNLEDQIISEDPDTIAAMIVEPITGASGVIVPPDGYYEGLQALLRKYGI
LIWADEVICGFGRTGADFGCTTMGITPDLMTFAKQLSSAYFPISASVIPGWMYEAMVDQT
NEVGVFGHGYTYSGHPAACAAALKTLEIYERDNLFDHAAEVGSYLQTQLREIFTDHPLVG
EVRGKGLIAALELVSNKTTGASFDKGRAGATAQRLCQDNGLILRAVAGNAVALCPPLIIT
REEVDDMLTRLKTAIDASYEELKAGGHLAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory