Comparing GFF92 Psest_0092 phosphonate C-P lyase system protein PhnK to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
72% identity, 94% coverage: 16:269/270 of query aligns to 1:249/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
72% identity, 94% coverage: 16:269/270 of query aligns to 1:249/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
71% identity, 94% coverage: 16:269/270 of query aligns to 1:249/250 of 7z16I
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
34% identity, 93% coverage: 18:268/270 of query aligns to 4:259/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
34% identity, 93% coverage: 18:268/270 of query aligns to 3:258/310 of 4fwiB
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 94% coverage: 17:269/270 of query aligns to 1:241/241 of 4u00A
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
28% identity, 93% coverage: 17:267/270 of query aligns to 2:262/330 of P0AAH4
7mdyC Lolcde nucleotide-bound
37% identity, 77% coverage: 35:243/270 of query aligns to 23:221/226 of 7mdyC
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
37% identity, 77% coverage: 35:243/270 of query aligns to 26:224/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
37% identity, 77% coverage: 35:243/270 of query aligns to 23:221/222 of 7arlD
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 92% coverage: 21:268/270 of query aligns to 6:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 92% coverage: 21:268/270 of query aligns to 6:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 92% coverage: 21:268/270 of query aligns to 6:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 92% coverage: 21:268/270 of query aligns to 6:242/242 of 2oljA
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
36% identity, 77% coverage: 35:243/270 of query aligns to 25:223/229 of 7v8iD
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
30% identity, 83% coverage: 18:242/270 of query aligns to 1:223/232 of 1f3oA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
26% identity, 86% coverage: 16:246/270 of query aligns to 2:218/285 of 4yerA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
29% identity, 83% coverage: 18:242/270 of query aligns to 1:223/230 of 1l2tA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
36% identity, 84% coverage: 17:243/270 of query aligns to 3:222/648 of P75831
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 94% coverage: 14:267/270 of query aligns to 13:251/378 of P69874
Sites not aligning to the query:
>GFF92 Psest_0092 phosphonate C-P lyase system protein PhnK
MSAAEQLLPAASVSTEPLFAVRDLTRLYGPDKGCQGVSFDLYPGEVLGIVGESGSGKSTL
LSLLCGRCPPDRGSVQYRDAAGDWLDLYAASEAERRTLLRTEWGFVEQNPRDGLRMGVSA
GANIGERLMAQGVRHYGQLRAAGLDWLQQVEIDPARIDDLPRTFSGGMQQRLQIARNLVS
SPKLVFMDEPTGGLDVSVQARLLDLLRGLVRELDLAVVIVTHDLAVARLLADRLMVMRRS
RVVEAGLTDQILDDPQHPYTQLLVSSVLQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory