SitesBLAST
Comparing GFF922 FitnessBrowser__psRCH2:GFF922 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
26% identity, 53% coverage: 20:524/950 of query aligns to 14:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ F78), G75 (≠ A80), S76 (≠ A81), G77 (= G82), T78 (= T83), G79 (≠ S84), L80 (= L85), A83 (≠ Q88), C84 (≠ A89), P137 (= P140), G138 (≠ A141), E139 (≠ S142), A142 (= A146), T143 (≠ K147), G146 (= G150), N147 (≠ I151), S149 (≠ A153), T150 (≠ N154), A152 (≠ S156), G153 (≠ S157), E203 (= E258), G204 (= G259), I209 (= I264), E422 (= E483), H423 (= H484)
- binding fe (iii) ion: H377 (= H438), H384 (= H445), E422 (= E483)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
28% identity, 32% coverage: 220:525/950 of query aligns to 177:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: R317 (= R385), W321 (≠ F389), H368 (= H438), H375 (= H445), H413 (= H484)
- binding flavin-adenine dinucleotide: E200 (= E258), G201 (= G259), I206 (= I264), W321 (≠ F389), Y322 (≠ P390), E412 (= E483), H413 (= H484), N449 (= N520)
- binding manganese (ii) ion: H368 (= H438), H375 (= H445), E412 (= E483)
Sites not aligning to the query:
- binding 2-Ketohexanoic acid: 75
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
25% identity, 50% coverage: 50:527/950 of query aligns to 40:458/459 of P9WIT1
- K354 (≠ E416) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
28% identity, 32% coverage: 220:525/950 of query aligns to 177:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R385), W322 (≠ F389), H369 (= H438), H376 (= H445), H414 (= H484)
- binding flavin-adenine dinucleotide: E200 (= E258), G201 (= G259), I206 (= I264), W322 (≠ F389), E413 (= E483), N450 (= N520)
- binding manganese (ii) ion: H369 (= H438), H376 (= H445), E413 (= E483)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
28% identity, 32% coverage: 220:525/950 of query aligns to 177:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E200 (= E258), G201 (= G259), I206 (= I264), W322 (≠ F389), E413 (= E483), H414 (= H484), N450 (= N520)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R385), H369 (= H438), H376 (= H445), H414 (= H484)
- binding manganese (ii) ion: H369 (= H438), H376 (= H445), E413 (= E483)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
28% identity, 32% coverage: 220:525/950 of query aligns to 177:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R385), H369 (= H438), H376 (= H445), H414 (= H484)
- binding flavin-adenine dinucleotide: E200 (= E258), G201 (= G259), I206 (= I264), W322 (≠ F389), E413 (= E483), H414 (= H484), N450 (= N520)
- binding manganese (ii) ion: H369 (= H438), H376 (= H445), E413 (= E483)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
28% identity, 32% coverage: 220:525/950 of query aligns to 177:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E200 (= E258), G201 (= G259), I206 (= I264), W323 (≠ F389), E414 (= E483), H415 (= H484), N451 (= N520)
- binding manganese (ii) ion: H370 (= H438), H377 (= H445), E414 (= E483)
- binding pyruvic acid: R319 (= R385), H370 (= H438), H377 (= H445), H415 (= H484)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
24% identity, 50% coverage: 51:521/950 of query aligns to 49:461/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (≠ F78), G78 (≠ A80), G79 (≠ A81), N80 (≠ G82), T81 (= T83), G82 (≠ S84), M83 (≠ L85), G86 (≠ Q88), S87 (≠ A89), L140 (≠ P140), A142 (≠ S142), C146 (≠ A146), H147 (≠ K147), G150 (= G150), N151 (≠ I151), A153 (= A153), T154 (≠ N154), G208 (= G259), I212 (≠ F263), I213 (= I264), E423 (= E483), N460 (= N520)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
24% identity, 50% coverage: 51:521/950 of query aligns to 101:513/521 of Q8N465
- S109 (≠ E59) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ T77) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (≠ A81) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V97) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ N103) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ A127) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (vs. gap) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A153) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (= A179) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G181) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (= D374) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R385) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ F389) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (= V402) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ I404) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ I422) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ R429) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H438) binding ; mutation to A: Loss of catalytic activity.
- G436 (≠ L440) to V: slight reduction in catalytic activity
- N439 (= N443) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H445) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ V447) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ F448) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ Q450) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E483) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H484) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G485) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
24% identity, 50% coverage: 51:521/950 of query aligns to 48:460/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R385), T337 (≠ F389), K348 (≠ I404), Y379 (≠ F436), H381 (= H438), H388 (= H445), H423 (= H484)
- binding flavin-adenine dinucleotide: P75 (≠ F78), Q76 (≠ R79), G77 (≠ A80), G78 (≠ A81), N79 (≠ G82), T80 (= T83), G81 (≠ S84), M82 (≠ L85), G85 (≠ Q88), S86 (≠ A89), L139 (≠ P140), G140 (≠ A141), A141 (≠ S142), C145 (≠ A146), G149 (= G150), N150 (≠ I151), A152 (= A153), T153 (≠ N154), G157 (= G158), G207 (= G259), I212 (= I264), E422 (= E483), N459 (= N520)
- binding zinc ion: H381 (= H438), H388 (= H445), E422 (= E483)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
24% identity, 50% coverage: 51:521/950 of query aligns to 48:460/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (≠ F78), G77 (≠ A80), G78 (≠ A81), N79 (≠ G82), T80 (= T83), G81 (≠ S84), G85 (≠ Q88), S86 (≠ A89), L139 (≠ P140), G140 (≠ A141), A141 (≠ S142), C145 (≠ A146), H146 (≠ K147), G148 (= G149), G149 (= G150), N150 (≠ I151), A152 (= A153), T153 (≠ N154), A155 (≠ S156), E206 (= E258), G207 (= G259), I211 (≠ F263), I212 (= I264), E422 (= E483), N459 (= N520)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R385), T337 (≠ F389), K348 (≠ I404), Y379 (≠ F436), H381 (= H438), H388 (= H445), H423 (= H484)
- binding zinc ion: H381 (= H438), H388 (= H445), E422 (= E483)
Sites not aligning to the query:
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
24% identity, 50% coverage: 51:521/950 of query aligns to 48:460/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (≠ F78), G77 (≠ A80), G78 (≠ A81), N79 (≠ G82), T80 (= T83), G81 (≠ S84), G85 (≠ Q88), S86 (≠ A89), L139 (≠ P140), G140 (≠ A141), A141 (≠ S142), C145 (≠ A146), H146 (≠ K147), G149 (= G150), N150 (≠ I151), A152 (= A153), T153 (≠ N154), A155 (≠ S156), G157 (= G158), E206 (= E258), G207 (= G259), I211 (≠ F263), I212 (= I264), E422 (= E483), N459 (= N520)
- binding d-malate: M82 (≠ L85), R333 (= R385), T337 (≠ F389), K348 (≠ I404), Y379 (≠ F436), H381 (= H438), H388 (= H445), E422 (= E483), H423 (= H484)
- binding zinc ion: H381 (= H438), H388 (= H445), E422 (= E483)
Sites not aligning to the query:
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
24% identity, 50% coverage: 51:521/950 of query aligns to 48:460/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R385), T337 (≠ F389), K348 (≠ I404), Y379 (≠ F436), H381 (= H438), H388 (= H445), N390 (≠ V447), H423 (= H484)
- binding flavin-adenine dinucleotide: P75 (≠ F78), G77 (≠ A80), G78 (≠ A81), N79 (≠ G82), T80 (= T83), G81 (≠ S84), M82 (≠ L85), G85 (≠ Q88), S86 (≠ A89), L139 (≠ P140), G140 (≠ A141), A141 (≠ S142), C145 (≠ A146), G149 (= G150), N150 (≠ I151), A152 (= A153), T153 (≠ N154), A155 (≠ S156), G157 (= G158), G207 (= G259), I212 (= I264), E422 (= E483), H423 (= H484)
- binding zinc ion: H381 (= H438), H388 (= H445), E422 (= E483)
Sites not aligning to the query:
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
28% identity, 32% coverage: 220:525/950 of query aligns to 177:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: E200 (= E258), G201 (= G259), I206 (= I264), W322 (≠ F389), E413 (= E483), H414 (= H484), N450 (= N520)
- binding lactic acid: R318 (= R385), H369 (= H438), H376 (= H445), H414 (= H484)
- binding manganese (ii) ion: H369 (= H438), H376 (= H445), E413 (= E483)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
24% identity, 54% coverage: 12:525/950 of query aligns to 2:465/465 of 3pm9A
- active site: A149 (≠ S156), L159 (≠ N166)
- binding flavin-adenine dinucleotide: P69 (≠ F78), Q70 (≠ R79), G71 (≠ A80), G72 (≠ A81), N73 (≠ G82), T74 (= T83), G75 (≠ S84), L76 (= L85), G79 (≠ Q88), Q80 (≠ A89), L91 (= L98), L133 (≠ P140), G134 (≠ A141), A135 (≠ S142), C139 (≠ A146), T140 (≠ K147), G142 (= G149), G143 (= G150), S146 (≠ A153), T147 (≠ N154), A149 (≠ S156), G150 (≠ S157), E200 (= E258), G201 (= G259), I205 (≠ F263), I206 (= I264), E423 (= E483)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
27% identity, 32% coverage: 220:525/950 of query aligns to 177:456/456 of 8jdrA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
27% identity, 32% coverage: 220:525/950 of query aligns to 177:456/456 of 8jdqA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
27% identity, 32% coverage: 220:525/950 of query aligns to 177:456/456 of 8jdoA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
27% identity, 32% coverage: 220:525/950 of query aligns to 177:456/456 of 8jdnA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
27% identity, 32% coverage: 220:525/950 of query aligns to 177:456/456 of 8jdgA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
Query Sequence
>GFF922 FitnessBrowser__psRCH2:GFF922
MNAAAQLERAPLPAEFLREVERVIPVERRFDDPLSTLAFGTDASFYRLIPKLVVRVESEA
EVIALLKLAHAENVPVTFRAAGTSLSGQAISDSVLIVLGDNWNGREIRNGGEQIRLQPGV
IGANANAVLAPFQRKIGPDPASINAAKIGGIVANNSSGMCCGTAQNTYKTLAGLRVVLAD
GTVVDSEDAASVDAFRQSHAALLEQLAELGRETRANSELAAKIRHKYRLKNTTGFSLNAL
VDYDEPLDILNHLMVGSEGTLGFISAVTYDTVPDHPHKASALVVFPDVETCCLAVPVLKQ
QPVSAVELLDRRSLRSVEHKVGMPEWVKELSPTACALLIESRAASQSLLHEQINLIMTSI
AHFPVEKQVDFSEDPVIYNQLWKIRKDTFPAVGAVRQTGTTVIIEDVTFPVERLAEGVNR
LIELLDKHRYDEAILFGHALEGNLHFVFTQGFDDPAQVARYEAFMGEVAQLVAVEFGGAL
KAEHGTGRNMAPFVELEWGSEAYALMWKIKRLLDPTGILNPDVVLSEDPDIHLKNLKPMP
AADEIVDKCIECGFCEPVCPSNGLTLTPRQRIVIWRDIQARKRAGVDTTEIERLYHYHGI
ETCAATGLCAQRCPVGINTGDLIRKLRGREASKTGAANWLADHFATAVQGTRFMLHAANG
AHIILGTKRLAKLSATMTNASKGRVPQWTPATPQPLQRLHLPKPTAQDERPRVVYLAACV
SRAMAPAARDQEQEPLLDKTRSLLEKAGYQVIFPEQLNDLCCGQPFASKGYAEQGERKRQ
EMLDALLKASRGGLDPIYCDTSPCTLRLVQGLTDQRLDLYDPVRFIRTYLLDKLDFVPQE
KAIAVHVTCSTQHLGEAQALIDIARRCAKEVVVPEGIHCCGFAGDKGFTTPELNCHALRS
LKDAVQICDEGISTSRTCEIGLSRHGEIDYHGLVYLVDRVTRSKTATPTL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory