Comparing GFF93 FitnessBrowser__WCS417:GFF93 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
38% identity, 92% coverage: 10:418/443 of query aligns to 12:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
38% identity, 92% coverage: 10:418/443 of query aligns to 12:423/427 of 5e9sA
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
38% identity, 92% coverage: 10:418/443 of query aligns to 10:421/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
38% identity, 92% coverage: 10:418/443 of query aligns to 9:420/424 of 6zl4A
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
38% identity, 92% coverage: 10:418/443 of query aligns to 5:412/416 of 6r7rA
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
36% identity, 91% coverage: 10:412/443 of query aligns to 14:417/425 of O59010
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
36% identity, 91% coverage: 10:412/443 of query aligns to 14:417/419 of 6x15A
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
36% identity, 91% coverage: 10:411/443 of query aligns to 5:407/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
36% identity, 91% coverage: 10:412/443 of query aligns to 6:409/409 of 6bavA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
36% identity, 91% coverage: 10:411/443 of query aligns to 11:413/413 of 6x14A
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
36% identity, 91% coverage: 10:411/443 of query aligns to 6:408/408 of 6bauA
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
35% identity, 91% coverage: 10:411/443 of query aligns to 6:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
31% identity, 84% coverage: 45:418/443 of query aligns to 57:412/412 of 7awmA
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
30% identity, 87% coverage: 15:401/443 of query aligns to 18:404/424 of 7xr6A
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
30% identity, 87% coverage: 15:401/443 of query aligns to 17:405/425 of 7xr4A
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
28% identity, 86% coverage: 45:425/443 of query aligns to 82:533/573 of P31596
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
28% identity, 88% coverage: 45:432/443 of query aligns to 56:500/503 of Q10901
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
28% identity, 90% coverage: 12:411/443 of query aligns to 58:501/543 of P56564
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
31% identity, 84% coverage: 45:417/443 of query aligns to 49:397/397 of 5mjuA
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
28% identity, 86% coverage: 45:425/443 of query aligns to 82:532/572 of P43006
Sites not aligning to the query:
>GFF93 FitnessBrowser__WCS417:GFF93
MKKAKLSLAWQILIGLVLGIAIGAVLNHFSAEKAWWISNVLQPAGDIFIRLIKMIVIPIV
ISSLIVGIAGVGDAKKLGRIGVKTILYFEIVTTIAIVVGLLLANLFHPGAGIDMSTLGTV
DISKYTATAAEVQHEHAFIETILNLIPSNIFAAVARGEMLPIIFFSVLFGLGLSSLKPEL
REPLVTMFQGVSESMFKVTHMIMKYAPIGVFALIAVTVANFGFASLLPLAKLVILVYVAI
LFFAFVILGLIARLFGFSVVKLMRIFKDELVLAYSTASSETVLPRVIEKMEAYGAPKAIC
SFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSVGQQLMLVLTLMVTSKGIAGVPGVS
FVVLLATLGSVGIPLEGLAFIAGVDRIMDMARTALNVIGNALAVLVISRWEGMYDDAKGE
RYWNSLPHWRSKDAAPVAQATRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory