SitesBLAST
Comparing GFF939 FitnessBrowser__Phaeo:GFF939 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P77454 Glutaminase 1; EC 3.5.1.2 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 100% coverage: 2:304/304 of query aligns to 4:308/310 of P77454
- K69 (= K68) mutation to A: Loss of activity.
- N117 (= N115) mutation to A: Loss of activity.
- S160 (= S160) mutation to A: Loss of activity.
- E161 (= E161) mutation to A: Strongly reduced activity.
- Q162 (≠ T162) mutation to A: No effect.
- N168 (= N168) mutation to A: Loss of activity.
- Y192 (= Y192) mutation to A: Loss of activity.
- Y244 (= Y240) mutation to A: Loss of activity.
- S260 (= S256) mutation to A: Reduced activity.
- K294 (≠ E290) modified: N6-acetyllysine
6umfA Crystal structure of human gac in complex with inhibitor upgl00012
38% identity, 95% coverage: 9:296/304 of query aligns to 95:386/409 of 6umfA
- active site: S150 (= S65), K153 (= K68), Y278 (= Y192), Y330 (= Y240), V348 (= V258)
- binding N-(5-{[1-(5-amino-1,3,4-thiadiazol-2-yl)piperidin-4-yl]oxy}-1,3,4-thiadiazol-2-yl)-2-phenylacetamide: L185 (≠ I99), L187 (≠ E103), Y258 (≠ F174)
6uljA Crystal structure of human gac in complex with inhibitor upgl00012
38% identity, 95% coverage: 9:296/304 of query aligns to 95:386/409 of 6uljA
6ulaA Crystal structure of human gac in complex with inhibitor upgl00012
38% identity, 95% coverage: 9:296/304 of query aligns to 95:386/409 of 6ulaA
- active site: S150 (= S65), K153 (= K68), Y278 (= Y192), Y330 (= Y240), V348 (= V258)
- binding 2-cyclopropyl-N-{5-[4-({5-[(cyclopropylacetyl)amino]-1,3,4-thiadiazol-2-yl}oxy)piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S98), L185 (≠ I99), F186 (≠ L102), L187 (≠ E103), N188 (≠ H104), Y258 (≠ F174)
6ukbA Crystal structure of human gac in complex with inhibitor upgl00012
38% identity, 95% coverage: 9:296/304 of query aligns to 95:386/409 of 6ukbA
- active site: S150 (= S65), K153 (= K68), Y278 (= Y192), Y330 (= Y240), V348 (= V258)
- binding N-[5-(4-{[5-(acetylamino)-1,3,4-thiadiazol-2-yl]oxy}piperidin-1-yl)-1,3,4-thiadiazol-2-yl]acetamide: K184 (≠ S98), L185 (≠ I99), F186 (≠ L102), L187 (≠ E103), Y258 (≠ F174)
6ujmA Crystal structure of human gac in complex with inhibitor upgl00013
38% identity, 95% coverage: 9:296/304 of query aligns to 95:386/409 of 6ujmA
- active site: S150 (= S65), K153 (= K68), Y278 (= Y192), Y330 (= Y240), V348 (= V258)
- binding N-{5-[(3R)-3-{[5-(acetylamino)-1,3,4-thiadiazol-2-yl]amino}pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S98), L185 (≠ I99), F186 (≠ L102), L187 (≠ E103), Y258 (≠ F174)
6umcB Crystal structure of human gac in complex with inhibitor upgl00012
38% identity, 95% coverage: 9:296/304 of query aligns to 95:386/410 of 6umcB
- active site: S150 (= S65), K153 (= K68), Y278 (= Y192), Y330 (= Y240), V348 (= V258)
- binding 2-phenyl-N-{5-[(3R)-3-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}oxy)pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S98), L185 (≠ I99), F186 (≠ L102), L187 (≠ E103), E189 (= E105), Y258 (≠ F174)
6ujgA Crystal structure of human gac in complex with inhibitor upgl00012
38% identity, 95% coverage: 9:296/304 of query aligns to 95:386/410 of 6ujgA
- active site: S150 (= S65), K153 (= K68), Y278 (= Y192), Y330 (= Y240), V348 (= V258)
- binding N-{5-[(3S)-3-{[5-(acetylamino)-1,3,4-thiadiazol-2-yl]amino}pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S98), L185 (≠ I99), F186 (≠ L102), L187 (≠ E103), Y258 (≠ F174)
5wj6A Crystal structure of glutaminasE C in complex with inhibitor 2-phenyl- n-{5-[4-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}amino) piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide (upgl-00004) (see paper)
38% identity, 95% coverage: 9:296/304 of query aligns to 95:386/410 of 5wj6A
- active site: S150 (= S65), K153 (= K68), Y278 (= Y192), Y330 (= Y240), V348 (= V258)
- binding 2-phenyl-N-{5-[4-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}amino)piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: R181 (≠ A95), K184 (≠ S98), L185 (≠ I99), F186 (≠ L102), L187 (≠ E103), N188 (≠ H104), E189 (= E105), Y258 (≠ F174)
5i94A Crystal structure of human glutaminasE C in complex with the inhibitor upgl-00019 (see paper)
38% identity, 95% coverage: 9:296/304 of query aligns to 95:386/410 of 5i94A
- active site: S150 (= S65), K153 (= K68), Y278 (= Y192), Y330 (= Y240), V348 (= V258)
- binding 2-phenyl-N-{5-[4-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}oxy)piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: R181 (≠ A95), K184 (≠ S98), L185 (≠ I99), F186 (≠ L102), Y258 (≠ F174)
4o7dA Crystal structure of human glutaminase in complex don (see paper)
37% identity, 96% coverage: 9:301/304 of query aligns to 13:309/313 of 4o7dA
- active site: S68 (= S65), K71 (= K68), Y196 (= Y192), Y248 (= Y240), V266 (= V258)
- binding 5-oxo-l-norleucine: Y31 (= Y28), Q67 (= Q64), S68 (= S65), N117 (= N115), E163 (= E161), Y196 (= Y192), Y248 (= Y240), G265 (= G257), V266 (= V258)
8bsnA Human gls in complex with compound 27 (see paper)
37% identity, 96% coverage: 9:301/304 of query aligns to 10:306/311 of 8bsnA
6loxA Crystal structure of human glutaminase with macrocyclic inhibitor (see paper)
37% identity, 95% coverage: 9:296/304 of query aligns to 93:384/407 of 6loxA
- active site: S148 (= S65), K151 (= K68), Y276 (= Y192), Y328 (= Y240), V346 (= V258)
- binding (E)-15,22-Dioxa-4,11-diaza-5(2,5)-thiadiazola-10(3,6)-pyridazina-1,14(1,3)-dibenzenacyclodocosaphan-18-ene-3,12-dione: K182 (≠ S98), L183 (≠ I99), F184 (≠ L102), L185 (≠ E103), N186 (≠ H104), Y256 (≠ F174)
8jueA Crystal structure of glutaminasE C in complex with compound 11 (see paper)
37% identity, 95% coverage: 9:296/304 of query aligns to 88:379/401 of 8jueA
8jubA Crystal structure of glutaminasE C in complex with compound 27 (see paper)
37% identity, 95% coverage: 9:296/304 of query aligns to 87:378/401 of 8jubA
6umdB Crystal structure of human gac in complex with inhibitor upgl00012
37% identity, 95% coverage: 9:296/304 of query aligns to 95:386/409 of 6umdB
- active site: S150 (= S65), K153 (= K68), Y278 (= Y192), Y330 (= Y240), V348 (= V258)
- binding 2-(pyridin-3-yl)-N-(5-{4-[(5-{[(pyridin-3-yl)acetyl]amino}-1,3,4-thiadiazol-2-yl)amino]piperidin-1-yl}-1,3,4-thiadiazol-2-yl)acetamide: R181 (≠ A95), K184 (≠ S98), L185 (≠ I99), F186 (≠ L102), L187 (≠ E103), N188 (≠ H104), E189 (= E105), Y258 (≠ F174)
6ul9B Crystal structure of human gac in complex with inhibitor upgl00023
37% identity, 95% coverage: 9:296/304 of query aligns to 95:386/409 of 6ul9B
- active site: S150 (= S65), K153 (= K68), Y278 (= Y192), Y330 (= Y240), V348 (= V258)
- binding 2-phenyl-N-{5-[(1-{5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}azetidin-3-yl)oxy]-1,3,4-thiadiazol-2-yl}acetamide: R181 (≠ A95), K184 (≠ S98), L185 (≠ I99), F186 (≠ L102), L187 (≠ E103), N188 (≠ H104), E189 (= E105), Y258 (≠ F174)
5fi7A Crystal structure of human gac in complex with inhibitor upgl_00015: 2-phenyl-~{n}-[5-[(3~{s})-3-[[5-(2-phenylethanoylamino)-1,3,4- thiadiazol-2-yl]oxy]pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl]ethanamide (see paper)
37% identity, 95% coverage: 9:296/304 of query aligns to 95:386/410 of 5fi7A
- active site: S150 (= S65), K153 (= K68), Y278 (= Y192), Y330 (= Y240), V348 (= V258)
- binding 2-phenyl-~{N}-[5-[(3~{S})-3-[[5-(2-phenylethanoylamino)-1,3,4-thiadiazol-2-yl]oxy]pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl]ethanamide: K184 (≠ S98), L185 (≠ I99), F186 (≠ L102), L187 (≠ E103), E189 (= E105), Y258 (≠ F174)
5fi6A Crystal structure of human gac in complex with inhibitor upgl_00011: 2-phenyl-~{n}-[5-[[(3~{s})-1-[5-(2-phenylethanoylamino)-1,3,4- thiadiazol-2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2- yl]ethanamide (see paper)
37% identity, 95% coverage: 9:296/304 of query aligns to 95:386/410 of 5fi6A
- active site: S150 (= S65), K153 (= K68), Y278 (= Y192), Y330 (= Y240), V348 (= V258)
- binding 2-phenyl-~{N}-[5-[[(3~{S})-1-[5-(2-phenylethanoylamino)-1,3,4-thiadiazol-2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2-yl]ethanamide: R181 (≠ A95), F182 (= F96), K184 (≠ S98), L185 (≠ I99), F186 (≠ L102), L187 (≠ E103), N188 (≠ H104), E189 (= E105), Y258 (≠ F174)
5fi2A Crystal structure of human gac in complex with inhibitor upgl_00009: 2-phenyl-~{n}-[5-[[(3~{r})-1-[5-(2-phenylethanoylamino)-1,3,4- thiadiazol- 2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2- yl]ethanamide (see paper)
37% identity, 95% coverage: 9:296/304 of query aligns to 95:386/410 of 5fi2A
- active site: S150 (= S65), K153 (= K68), Y278 (= Y192), Y330 (= Y240), V348 (= V258)
- binding 2-phenyl-~{N}-[5-[[(3~{R})-1-[5-(2-phenylethanoylamino)-1,3,4-thiadiazol-2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2-yl]ethanamide: K184 (≠ S98), L185 (≠ I99), F186 (≠ L102), L187 (≠ E103), Y258 (≠ F174)
Query Sequence
>GFF939 FitnessBrowser__Phaeo:GFF939
MAAKLQRVLDEISQQMRASTDWGEVASYIPELGEVRPDQFAISVATADGGLFSAGDFQTR
FSAQSITKVFTLAIALGRAGDQLWHRVGREPSGTAFNSIVQLEHEQGRPRNPFVNAGAIV
TTDEVLAGREPREALAEFLGFVRAAAEDDDIHINADVARSETAHGHRNAAHAHFLASFGN
LKNPPEKVLGTYFHHCATEMTTQQLAKAGRFLIGTGSYPRMVSLDRVRRLNALMLTCGHY
DGSGEFAYRVGLPAKSGVGGGILGVVPGQASIAVWSPGLNRNGNSKLGTEAMEQLAREMD
WSVF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory