SitesBLAST
Comparing GFF941 FitnessBrowser__WCS417:GFF941 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P40471 NADPH-dependent 1-acyldihydroxyacetone phosphate reductase; ADR; 1-acyl DHAP reductase; Acyl/alkyl DHAP reductase; Acylglycerone-phosphate reductase; Triacylglycerol lipase AYR1; TAG lipase; EC 1.1.1.101; EC 3.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 97% coverage: 5:266/270 of query aligns to 13:281/297 of P40471
- S18 (= S10) mutation to A: Completely abolishes lipase activity.
3hb4X 17beta-hydroxysteroid dehydrogenase type1 complexed with e2b (see paper)
34% identity, 90% coverage: 4:247/270 of query aligns to 5:263/284 of 3hb4X
- binding 3-{[(9beta,14beta,16alpha,17alpha)-3,17-dihydroxyestra-1,3,5(10)-trien-16-yl]methyl}benzamide: S142 (= S126), G144 (≠ S128), L149 (≠ T133), Y155 (= Y139), F192 (= F176), H221 (≠ D199)
3dheA Estrogenic 17-beta hydroxysteroid dehydrogenase complexed dehydroepiandrosterone (see paper)
34% identity, 90% coverage: 4:247/270 of query aligns to 5:263/284 of 3dheA
1equA Type 1 17-beta hydroxysteroid dehydrogenase equilin complexed with NADP+ (see paper)
34% identity, 90% coverage: 4:247/270 of query aligns to 5:263/284 of 1equA
- binding equilin: S142 (= S126), V143 (= V127), L149 (≠ T133), Y155 (= Y139), Y218 (≠ P196), R258 (= R242)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S11 (= S10), S12 (= S11), G13 (= G12), I14 (= I13), R37 (vs. gap), D65 (= D52), V66 (= V53), N90 (= N75), A91 (= A76), G92 (= G77), L93 (≠ Y78), T140 (≠ I124), G141 (= G125), S142 (= S126), Y155 (= Y139), V188 (≠ I172), T190 (= T174), A191 (≠ S175), F192 (= F176)
1dhtA Estrogenic 17-beta hydroxysteroid dehydrogenase complexed dihydrotestosterone (see paper)
34% identity, 90% coverage: 4:247/270 of query aligns to 5:263/284 of 1dhtA
Sites not aligning to the query:
1i5rA Type 1 17-beta hydroxysteroid dehydrogenase em1745 complex (see paper)
34% identity, 90% coverage: 4:247/270 of query aligns to 5:263/285 of 1i5rA
- binding o5'-[9-(3,17b-dihydroxy-1,3,5(10)-estratrien-16b-yl)-nonanoyl]adenosine: G9 (= G8), S11 (= S10), S12 (= S11), R37 (vs. gap), L64 (= L51), D65 (= D52), V66 (= V53), R67 (≠ N54), A91 (= A76), G92 (= G77), L93 (≠ Y78), G94 (= G79), S142 (= S126), G144 (≠ S128), M147 (≠ L131), L149 (≠ T133), Y155 (= Y139), G186 (= G170), F192 (= F176), M193 (≠ A177), Y218 (≠ P196), H221 (≠ D199), V225 (≠ A203), F259 (≠ A243)
1a27A Human 17-beta-hydroxysteroid-dehydrogenase type 1 c-terminal deletion mutant complexed with estradiol and NADP+
34% identity, 90% coverage: 4:247/270 of query aligns to 5:263/285 of 1a27A
- binding estradiol: S142 (= S126), V143 (= V127), G144 (≠ S128), M147 (≠ L131), L149 (≠ T133), Y155 (= Y139), V225 (≠ A203), F259 (≠ A243)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), S11 (= S10), S12 (= S11), G13 (= G12), R37 (vs. gap), D65 (= D52), V66 (= V53), N90 (= N75), A91 (= A76), G92 (= G77), T140 (≠ I124), S142 (= S126), K159 (= K143), C185 (≠ P169), G186 (= G170), P187 (≠ A171), V188 (≠ I172), T190 (= T174), F192 (= F176)
Sites not aligning to the query:
P14061 17-beta-hydroxysteroid dehydrogenase type 1; 17-beta-HSD 1; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-HSD; E2DH; Estradiol 17-beta-dehydrogenase 1; Placental 17-beta-hydroxysteroid dehydrogenase; Short chain dehydrogenase/reductase family 28C member 1; EC 1.1.1.51; EC 1.1.1.62 from Homo sapiens (Human) (see 12 papers)
34% identity, 90% coverage: 4:247/270 of query aligns to 6:264/328 of P14061
- 10:38 (vs. 8:23, 38% identical) binding
- D66 (= D52) binding
- LDV 112:114 (≠ FET 96:98) mutation to F: Loss of 17-beta-hydroxysteroid dehydrogenase activity.
- S135 (≠ K118) modified: Phosphoserine; by PKA; mutation to A: Abolishes phosphorylation. No effect on 17-beta-hydroxysteroid dehydrogenase activity.
- S143 (= S126) binding ; mutation to A: Loss of 17-beta-hydroxysteroid dehydrogenase activity.
- L150 (≠ T133) mutation to V: Alters substrate specificity.
- Y156 (= Y139) mutation to A: Loss of 17-beta-hydroxysteroid dehydrogenase activity.
- K160 (= K143) binding ; mutation to A: Loss of 17-beta-hydroxysteroid dehydrogenase activity.
- A171 (≠ R154) mutation to AEF: Loss of 17-beta-hydroxysteroid dehydrogenase activity.
- H222 (≠ D199) mutation to A: No effect on conversion of estrone to 17beta-estradiol.
- A238 (= A215) to V: in dbSNP:rs147402365
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 283 E→A: No effect on conversion of estrone to 17beta-estradiol.; E→Q: No effect on conversion of estrone to 17beta-estradiol.
- 313 G → S: in dbSNP:rs605059
1fdvA Human 17-beta-hydroxysteroid-dehydrogenase type 1 mutant h221l complexed with NAD+ (see paper)
34% identity, 90% coverage: 4:247/270 of query aligns to 5:263/285 of 1fdvA
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), S11 (= S10), S12 (= S11), R37 (vs. gap), D65 (= D52), N90 (= N75), A91 (= A76), G92 (= G77), T140 (≠ I124), G141 (= G125), C185 (≠ P169), V188 (≠ I172), T190 (= T174), F192 (= F176), K195 (≠ N179)
3km0A 17betahsd1 in complex with 3beta-diol
36% identity, 90% coverage: 4:247/270 of query aligns to 5:257/278 of 3km0A
- binding 5-alpha-androstane-3-beta,17beta-diol: V143 (= V127), L149 (≠ T133), P187 (≠ A171), H215 (≠ D199), S216 (≠ G200), F220 (≠ R204), F253 (≠ A243)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), S11 (= S10), S12 (= S11), I14 (= I13), G15 (= G14), R37 (vs. gap), D65 (= D52), V66 (= V53), N90 (= N75), A91 (= A76), G92 (= G77), V113 (≠ T98), T140 (≠ I124), G141 (= G125), K159 (= K143), C185 (≠ P169), G186 (= G170), P187 (≠ A171), V188 (≠ I172)
6dtpA Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 1 complexed with em139
36% identity, 90% coverage: 4:247/270 of query aligns to 5:257/279 of 6dtpA
- binding N-butyl-11-[(7alpha,9beta,13alpha,14beta,16alpha,17alpha)-16-chloro-3,17-dihydroxyestra-1,3,5(10)-trien-7-yl]-N-methylundecanamide: S142 (= S126), V143 (= V127), P187 (≠ A171), Y212 (vs. gap), H215 (≠ D199), S216 (≠ G200), F220 (≠ R204)
3p19A Improved NADPH-dependent blue fluorescent protein (see paper)
34% identity, 84% coverage: 4:230/270 of query aligns to 5:223/239 of 3p19A
- active site: S132 (= S126), Y145 (= Y139), K149 (= K143)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), S11 (= S10), S12 (= S11), G13 (= G12), I14 (= I13), A33 (= A32), R34 (= R33), R35 (= R34), D53 (= D52), V54 (= V53), N80 (= N75), A81 (= A76), G82 (= G77), I130 (= I124), S132 (= S126), Y145 (= Y139), K149 (= K143), P175 (= P169), A177 (= A171), V178 (≠ I172), T180 (= T174), E181 (≠ S175), L182 (≠ F176)
6cgcA Crystal structure of human 17beta-hsd type 1 in ternary complex with 2-meo-cc-156 and NADP+ (see paper)
34% identity, 90% coverage: 4:247/270 of query aligns to 5:256/278 of 6cgcA
- binding 3-{[(9beta,14beta,16alpha,17alpha)-3,17-dihydroxy-2-methoxyestra-1,3,5(10)-trien-16-yl]methyl}benzamide: G94 (= G79), L95 (≠ A80), V143 (= V127), L149 (≠ T133), N152 (≠ A136), Y155 (= Y139), Y211 (≠ P196), H214 (≠ D199), V218 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), S11 (= S10), S12 (= S11), R37 (vs. gap), D65 (= D52), V66 (= V53), A91 (= A76), G92 (= G77)
Sites not aligning to the query:
1jtvA Crystal structure of 17beta-hydroxysteroid dehydrogenase type 1 complexed with testosterone (see paper)
34% identity, 90% coverage: 4:247/270 of query aligns to 5:256/278 of 1jtvA
Sites not aligning to the query:
6cgeA Crystal structure of human 17beta-hsd type 1 in ternary complex with pbrm and NADP+ (see paper)
34% identity, 90% coverage: 4:247/270 of query aligns to 5:257/279 of 6cgeA
- binding 3-{[(14beta,16alpha,17alpha)-3-(2-bromoethyl)-17-hydroxyestra-1,3,5(10)-trien-16-yl]methyl}benzamide: G94 (= G79), L95 (≠ A80), L149 (≠ T133), N152 (≠ A136), Y155 (= Y139), G186 (= G170), Y212 (≠ P196), H215 (≠ D199), S216 (≠ G200), F253 (≠ A243)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), S11 (= S10), S12 (= S11), G13 (= G12), I14 (= I13), R37 (vs. gap), D65 (= D52), V66 (= V53), A91 (= A76), G92 (= G77)
Sites not aligning to the query:
6mncB Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 1 complexed with estrone (see paper)
35% identity, 90% coverage: 4:247/270 of query aligns to 5:255/276 of 6mncB
Sites not aligning to the query:
1qywA Crystal structure of human estrogenic 17beta-hydroxysteroid dehydrogenase complex with androstanedione and NADP (see paper)
35% identity, 90% coverage: 4:247/270 of query aligns to 5:255/276 of 1qywA
- binding 5alpha-androstan-3,17-dione: V143 (= V127), L149 (≠ T133), H213 (≠ D199), S214 (≠ G200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), S11 (= S10), R37 (vs. gap), D65 (= D52), V66 (= V53), A91 (= A76), G92 (= G77), V113 (≠ T98)
1qyxA Crystal structure of human estrogenic 17beta-hydroxysteroid dehydrogenase complex with androstenedione and NADP (see paper)
35% identity, 90% coverage: 4:247/270 of query aligns to 5:255/277 of 1qyxA
- binding 4-androstene-3-17-dione: V143 (= V127), P187 (≠ A171), H213 (≠ D199), S214 (≠ G200), F251 (≠ A243)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), S11 (= S10), S12 (= S11), R37 (vs. gap), D65 (= D52), V66 (= V53), A91 (= A76), G92 (= G77)
Sites not aligning to the query:
3klpX 17beta-hsd1 in complex with a-diol
34% identity, 90% coverage: 4:247/270 of query aligns to 5:254/276 of 3klpX
Sites not aligning to the query:
3rkuA Substrate fingerprint and the structure of NADP+ dependent serine dehydrogenase from saccharomyces cerevisiae complexed with NADP+
36% identity, 64% coverage: 4:177/270 of query aligns to 17:207/268 of 3rkuA
- active site: A107 (= A80), N128 (= N99), S156 (= S126), Y169 (= Y139), K173 (= K143)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G8), S23 (= S10), G25 (= G12), I26 (= I13), R49 (= R33), R50 (= R34), D76 (= D52), I77 (≠ V53), N103 (= N75), A104 (= A76), G105 (= G77), K106 (≠ G79), S156 (= S126), Y169 (= Y139), K173 (= K143), P199 (= P169), G200 (= G170), V202 (≠ I172), T204 (= T174), E205 (≠ S175), F206 (= F176)
Sites not aligning to the query:
Query Sequence
>GFF941 FitnessBrowser__WCS417:GFF941
MPNVLITGCSSGIGRALADAFKATGYRVWASARRAEDVAGLSAAGFNAVQLDVNDSAALQ
RLAEQLGELDVLVNNAGYGAMGPLLDGGTEAMQRQFETNVFSIVGVTQALFPALRRSKGV
VVNIGSVSGVLVTPFAGAYCASKAAVHALSDALRMELAPFGVRVMEVQPGAINTSFAKNA
GAQAELLINEQSPWWPLRDGIRARSQASQDKPTPANVFAADVLKAVQQPQPPRLLRSGNG
SRALPLMAALLPKGLLEKVLKKRFGLAGSL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory