Comparing GFF944 FitnessBrowser__Marino:GFF944 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3eq6A Crystal structure of human acyl-coa synthetase medium-chain family member 2a (l64p mutation) in a ternary complex with products (see paper)
33% identity, 93% coverage: 31:542/549 of query aligns to 8:530/533 of 3eq6A
3c5eA Crystal structure of human acyl-coa synthetase medium-chain family member 2a (l64p mutation) in complex with atp (see paper)
33% identity, 93% coverage: 31:542/549 of query aligns to 11:533/536 of 3c5eA
2wd9A Crystal structure of human acyl-coa synthetase medium-chain family member 2a (l64p mutation) in complex with ibuprofen (see paper)
33% identity, 93% coverage: 31:542/549 of query aligns to 8:530/533 of 2wd9A
2vzeA Crystal structure of human acyl-coa synthetase medium-chain family member 2a (l64p mutation) in complex with amp (see paper)
33% identity, 93% coverage: 31:542/549 of query aligns to 8:530/533 of 2vzeA
3b7wA Crystal structure of human acyl-coa synthetase medium-chain family member 2a, with l64p mutation (see paper)
33% identity, 93% coverage: 31:542/549 of query aligns to 12:534/537 of 3b7wA
3dayA Crystal structure of human acyl-coa synthetase medium-chain family member 2a (l64p mutation) in complex with amp-cpp (see paper)
33% identity, 93% coverage: 31:542/549 of query aligns to 12:532/535 of 3dayA
3gpcA Crystal structure of human acyl-coa synthetase medium-chain family member 2a (l64p mutation) in a complex with coa (see paper)
33% identity, 93% coverage: 31:542/549 of query aligns to 9:529/532 of 3gpcA
Q08AH3 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; Acyl-CoA synthetase medium-chain family member 2A; Benzoate--CoA ligase; Butyrate--CoA ligase 2A; Butyryl-coenzyme A synthetase 2A; Middle-chain acyl-CoA synthetase 2A; EC 6.2.1.2; EC 6.2.1.25 from Homo sapiens (Human) (see 4 papers)
33% identity, 93% coverage: 31:542/549 of query aligns to 44:566/577 of Q08AH3
P78773 Probable acetyl-coenzyme A synthetase; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 95% coverage: 28:547/549 of query aligns to 82:632/662 of P78773
7kvyA Crystal structure of acetyl-coa synthetase in complex with adenosine- 5'-ethylphosphate and co-enzyme a from coccidioides immitis rs
32% identity, 94% coverage: 25:541/549 of query aligns to 82:620/633 of 7kvyA
Q9NUB1 Acetyl-coenzyme A synthetase 2-like, mitochondrial; Acetate--CoA ligase 2; Acetyl-CoA synthetase 2; AceCS2; Acyl-CoA synthetase short-chain family member 1; Propionate--CoA ligase; EC 6.2.1.1; EC 6.2.1.17 from Homo sapiens (Human) (see 3 papers)
32% identity, 95% coverage: 23:546/549 of query aligns to 104:655/689 of Q9NUB1
Sites not aligning to the query:
Q99NB1 Acetyl-coenzyme A synthetase 2-like, mitochondrial; Acetate--CoA ligase 2; Acetyl-CoA synthetase 2; AceCS2; Acyl-CoA synthetase short-chain family member 1; Propionate--CoA ligase; EC 6.2.1.1; EC 6.2.1.17 from Mus musculus (Mouse) (see paper)
31% identity, 95% coverage: 23:541/549 of query aligns to 97:643/682 of Q99NB1
7l3qA Crystal structure of acetyl-coa synthetase in complex with adenosine- 5'-methylphosphate and co-enzyme a from coccidioides immitis rs
32% identity, 93% coverage: 25:534/549 of query aligns to 83:619/631 of 7l3qA
Q89WV5 Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 from Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) (see paper)
30% identity, 95% coverage: 28:549/549 of query aligns to 71:622/648 of Q89WV5
7kdnA Crystal structure of acetyl-coa synthetase in complex with adenosine- 5'-propylphosphate from aspergillus fumigatus
32% identity, 95% coverage: 20:541/549 of query aligns to 77:620/622 of 7kdnA
P52910 Acetyl-coenzyme A synthetase 2; Acetate--CoA ligase 2; Acyl-activating enzyme 2; EC 6.2.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 95% coverage: 27:546/549 of query aligns to 86:650/683 of P52910
8w0dA Acetyl-coenzyme A synthetase 2
32% identity, 94% coverage: 31:546/549 of query aligns to 87:637/666 of 8w0dA
8v4rA Crystal structure of acetyl-coa synthetase 2 in complex with amp and coa from candida albicans
32% identity, 94% coverage: 31:546/549 of query aligns to 87:637/666 of 8v4rA
8w0cA Acetyl-coenzyme A synthetase 2
32% identity, 94% coverage: 31:546/549 of query aligns to 88:638/667 of 8w0cA
8w0bA Acetyl-coenzyme A synthetase 2
32% identity, 94% coverage: 31:546/549 of query aligns to 88:638/667 of 8w0bA
>GFF944 FitnessBrowser__Marino:GFF944
MSLPEYTDVYNNFDPAALEADILDGRLDSGLNVCHEICDKWADDPSRVALYYETEDGGDG
TLTFAELKEASARFANYLKSQGIGKGDRVAALLPRTPELLIVIAGTLRAGAVYQPLFTAF
GSGAIEYRFERASTKLVVTNPENYPKLNDVKVCPPVVGVNASEIGADIPDFEETLAAQSS
DFEPVMIKGDDPFLQMFTSGTVGKSKGVAVPAKALLAFYVYMKYAIDLQDGDRFWNVADP
GWAYGLYYAVVGPLLMGHATHFNPGGFTPESTYDMIRKYKITNLAAAPTAYRLLKANDHV
LPEGENLGLRVASSAGEPLNPEVVNWIRNRHYCPVKDHYGQTETGMTCCNFHGLAHPVRE
GSMGYASPGHKVVALNEKNEVVGEGEVGQLAVDVKASPLFHFDGYTWGEKDPFVNGYYLT
GDMVINHGNGNFSFSGRDDDIITTAGYRVGPADVESTLLEHAAVAESGVVGKPDEKRGSI
IKAYVVIKGDYALGDEQALKDELQELVRRRLSTHAFPREIEFVDELPKTPSGKIQRFVLR
NQAKEEIGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory