Comparing GFF946 Psest_0975 triosephosphate isomerase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mvaA 1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate. (see paper)
49% identity, 99% coverage: 1:249/251 of query aligns to 1:249/255 of 4mvaA
B1XB85 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Escherichia coli (strain K12 / DH10B) (see paper)
49% identity, 99% coverage: 1:249/251 of query aligns to 1:249/255 of B1XB85
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
50% identity, 98% coverage: 2:248/251 of query aligns to 4:250/252 of 6neeB
P00942 Triosephosphate isomerase; TIM; Triose-phosphate isomerase; EC 5.3.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
45% identity, 98% coverage: 2:248/251 of query aligns to 3:246/248 of P00942
Sites not aligning to the query:
3ypiA Electrophilic catalysis in triosephosphase isomerase: the role of histidine-95 (see paper)
45% identity, 98% coverage: 2:248/251 of query aligns to 2:245/247 of 3ypiA
4ff7B Structure of c126s mutant of saccharomyces cerevisiae triosephosphate isomerase (see paper)
45% identity, 98% coverage: 2:248/251 of query aligns to 2:245/247 of 4ff7B
4ff7A Structure of c126s mutant of saccharomyces cerevisiae triosephosphate isomerase (see paper)
45% identity, 98% coverage: 2:248/251 of query aligns to 2:245/247 of 4ff7A
1ci1B Crystal structure of triosephosphate isomerase from trypanosoma cruzi in hexane (see paper)
45% identity, 98% coverage: 3:248/251 of query aligns to 4:247/249 of 1ci1B
5zfxB Crystal structure of triosephosphate isomerase from opisthorchis viverrini (see paper)
46% identity, 98% coverage: 2:248/251 of query aligns to 1:246/248 of 5zfxB
2y63A Crystal structure of leishmanial e65q-tim complexed with bromohydroxyacetone phosphate (see paper)
45% identity, 98% coverage: 3:248/251 of query aligns to 4:247/249 of 2y63A
2y61A Crystal structure of leishmanial e65q-tim complexed with s-glycidol phosphate (see paper)
45% identity, 98% coverage: 3:248/251 of query aligns to 4:247/249 of 2y61A
2vxnA E65q-tim complexed with phosphoglycolohydroxamate at 0.82 a resolution (see paper)
45% identity, 98% coverage: 3:248/251 of query aligns to 4:247/249 of 2vxnA
1if2A X-ray structure of leishmania mexicana triosephosphate isomerase complexed with ipp (see paper)
45% identity, 98% coverage: 3:248/251 of query aligns to 4:247/249 of 1if2A
1amkA Leishmania mexicana triose phosphate isomerase (see paper)
44% identity, 98% coverage: 3:248/251 of query aligns to 5:248/250 of 1amkA
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
46% identity, 98% coverage: 2:247/251 of query aligns to 402:650/654 of P36204
Sites not aligning to the query:
P50921 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Moritella marina (Vibrio marinus) (see paper)
44% identity, 94% coverage: 1:237/251 of query aligns to 1:239/256 of P50921
A0A1L5YRA2 Triosephosphate isomerase; TIM; Allergen Scy p 8; Methylglyoxal synthase; Triose-phosphate isomerase; Allergen Scy p 8.0101; EC 5.3.1.1; EC 4.2.3.3 from Scylla paramamosain (Mud crab) (see paper)
46% identity, 95% coverage: 2:240/251 of query aligns to 5:239/248 of A0A1L5YRA2
1aw1A Triosephosphate isomerase of vibrio marinus complexed with 2- phosphoglycolate (see paper)
44% identity, 94% coverage: 2:237/251 of query aligns to 1:238/255 of 1aw1A
P07669 Triosephosphate isomerase; TIM; Triose-phosphate isomerase; EC 5.3.1.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
46% identity, 98% coverage: 2:247/251 of query aligns to 3:245/249 of P07669
6ooiC Crystal structure of triosephosphate isomerase from schistosoma mansoni in complex with 2pg (see paper)
43% identity, 98% coverage: 2:248/251 of query aligns to 8:253/255 of 6ooiC
>GFF946 Psest_0975 triosephosphate isomerase
MRRPMVAGNWKMNGTRASVAELVESLRMQALPVSVEIAVFPSCLHVAQVLGGVDSKHVAV
GAQDCAAQNGFGALTGEVSAEQFAEVGCEWVLVGHSERRLVLGETDEVVSRKFLAAQVGG
LKPVLCLGETLEEREAGRTLEVVGRQLAQVLDDHGIAVFESAVIAYEPVWAIGSGLTATP
EQAQEVHAAIREQLSRQDRQVAAGVRLLYGGSVKADNAAELFSMADIDGGLVGGASLKAN
EFGAICRAAGN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory