SitesBLAST
Comparing GFF965 FitnessBrowser__Marino:GFF965 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 63% coverage: 11:266/408 of query aligns to 43:293/857 of Q63342
- CV 52:53 (≠ YT 20:21) binding
- EK 73:74 (≠ EA 40:41) binding
- 80:88 (vs. 47:56, 20% identical) binding
- H84 (≠ R51) modified: Tele-8alpha-FAD histidine
- V212 (= V190) binding
- W244 (≠ Y220) binding
Sites not aligning to the query:
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
24% identity, 63% coverage: 11:266/408 of query aligns to 6:256/824 of 4pabB
- active site: T53 (≠ N58), E102 (≠ H119), H226 (≠ S237), Y255 (= Y265)
- binding flavin-adenine dinucleotide: I11 (≠ V16), G12 (= G17), G14 (= G19), C15 (≠ Y20), V16 (≠ T21), L35 (= L39), E36 (= E40), K37 (≠ A41), G43 (= G47), S44 (≠ A48), T45 (≠ S49), H47 (≠ R51), A48 (≠ N52), A49 (≠ G53), G50 (= G54), L51 (≠ I56), V175 (= V190), A204 (≠ G217), G205 (≠ N218), W207 (≠ Y220), H226 (≠ S237), Y228 (≠ I239)
Sites not aligning to the query:
- active site: 536
- binding flavin-adenine dinucleotide: 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
20% identity, 88% coverage: 12:369/408 of query aligns to 3:349/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ V16), G8 (= G17), G10 (= G19), V11 (≠ Y20), I12 (≠ T21), V30 (≠ L39), E31 (= E40), K32 (≠ A41), E38 (≠ G47), A39 (= A48), S40 (= S49), A43 (≠ N52), G45 (= G54), L46 (≠ Q55), V171 (= V190), G200 (= G217), G201 (≠ N218), W203 (≠ Y220), G298 (= G320), R300 (≠ F322), P301 (≠ L323), Y326 (vs. gap), R327 (vs. gap), N328 (vs. gap), G329 (= G349), I330 (≠ V350)
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
21% identity, 82% coverage: 29:364/408 of query aligns to 23:351/374 of 1y56B
- active site: F44 (≠ G50), G47 (= G53), T48 (≠ G54), H224 (≠ S237), P239 (≠ Q252), G305 (= G320), M338 (≠ T351)
- binding flavin-adenine dinucleotide: I33 (≠ L39), E34 (= E40), K35 (≠ A41), S42 (≠ A48), T43 (≠ S49), R45 (= R51), C46 (≠ N52), G47 (= G53), G49 (≠ Q55), E170 (≠ T189), V171 (= V190), T200 (≠ G217), N201 (= N218), W203 (≠ Y220), G305 (= G320), Y306 (≠ N321), Y307 (≠ F322), G334 (= G347), H335 (= H348), G336 (= G349), F337 (≠ V350), M338 (≠ T351)
- binding flavin mononucleotide: F44 (≠ G50), R45 (= R51), I260 (≠ D275), R301 (≠ Y316), W303 (= W318)
Sites not aligning to the query:
Query Sequence
>GFF965 FitnessBrowser__Marino:GFF965
MRPALRGSCEADVCVVGAGYTGLSTALFLAEAGFRVVVLEAATVGWGASGRNGGQIVNSF
SRDLDSIERQTSQDHLKLLSEMAFEGSQIIRQRVKSYGIRCDLKEGGIFAALNPKQLRHL
ESQQALWRRFGYDQLELLDRNAIRSRVGTERYVGGAIDHTGGHIHPLNLALGEAAALESR
GGVIHEHSTVTSIAPGKTVTVRTDMGEVRAQTVVLAGNAYLGGLVPELGAKSMPCGSQII
ATEPLEEAVARQLLPNDNCVEDCNYLLDYFRLSGDNRLIYGGGVVYGARDPANIERLIRP
NMLKTFPQLANVKIDYAWTGNFLLTLSRLPQLGRLHENVFYSQGCSGHGVTFTHVAGKAL
GLAIQDQAERFDAFASLPHYPFPGGRAFRVPLTAMGAWYYALRDRLGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory