SitesBLAST
Comparing GFF974 FitnessBrowser__Phaeo:GFF974 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5oasA Crystal structure of malate synthase g from pseudomonas aeruginosa in apo form. (see paper)
63% identity, 99% coverage: 10:709/710 of query aligns to 13:725/728 of 5oasA
5vfbA 1.36 angstrom resolution crystal structure of malate synthase g from pseudomonas aeruginosa in complex with glycolic acid.
63% identity, 99% coverage: 10:709/710 of query aligns to 9:721/724 of 5vfbA
6axeA Crystal structure of a malate synthase g from mycobacterium marinum bound to acetyl coa
59% identity, 99% coverage: 9:710/710 of query aligns to 10:728/729 of 6axeA
- active site: D272 (= D261), E274 (= E263), R338 (= R329), E437 (= E419), D465 (= D447), D636 (= D619)
- binding acetyl coenzyme *a: V119 (= V118), V120 (= V119), R126 (= R125), F127 (= F126), N130 (= N129), A131 (= A130), R311 (= R302), R338 (= R329), M518 (= M500), W544 (= W526), P546 (= P528), P548 (= P530), C622 (= C605), K624 (= K607), M634 (= M617), D636 (= D619)
- binding magnesium ion: E437 (= E419), D465 (= D447)
P9WK16 Malate synthase G; EC 2.3.3.9 from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 9:725/741 of P9WK16
- R339 (= R329) active site, Proton acceptor
- D633 (= D619) active site, Proton donor
2gq3A Mycobacterium tuberculosis malate synthase in complex with magnesium, malate, and coenzyme a (see paper)
58% identity, 99% coverage: 9:709/710 of query aligns to 8:717/720 of 2gq3A
- active site: D267 (= D261), E269 (= E263), R335 (= R329), E430 (= E419), D458 (= D447), D626 (= D619)
- binding coenzyme a: V114 (= V118), V115 (= V119), R121 (= R125), F122 (= F126), N125 (= N129), A126 (= A130), K301 (= K295), R308 (= R302), P539 (= P528), P541 (= P530), C612 (= C605), M624 (= M617), D626 (= D619)
- binding magnesium ion: H370 (= H364), K373 (≠ Q367), N378 (= N372), G379 (vs. gap), L381 (vs. gap), E430 (= E419), D458 (= D447)
4ex4B The structure of glcb from mycobacterium leprae
58% identity, 99% coverage: 9:709/710 of query aligns to 7:721/721 of 4ex4B
- active site: D266 (= D261), E268 (= E263), R334 (= R329), E431 (= E419), D459 (= D447), D630 (= D619)
- binding magnesium ion: N290 (≠ M285), K291 (= K286), H371 (= H364), N379 (≠ E369), L382 (vs. gap), T383 (≠ G371), N384 (= N372), E431 (= E419), D459 (= D447)
6dkoA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-f-phenyldiketoacid (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 8:714/716 of 6dkoA
- active site: D270 (= D261), E272 (= E263), R332 (= R329), E424 (= E419), D452 (= D447), D622 (= D619)
- binding 4-(2,6-difluorophenyl)-2,4-dioxobutanoic acid: R332 (= R329), G449 (= G444), L451 (= L446), D452 (= D447), M505 (= M500), W531 (= W526), M620 (= M617), D622 (= D619)
- binding magnesium ion: E424 (= E419), D452 (= D447)
6c2xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-6-me-phenyldiketoacid (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 8:709/711 of 6c2xA
- active site: D268 (= D261), E270 (= E263), R328 (= R329), E418 (= E419), D446 (= D447), D617 (= D619)
- binding (2S)-4-(2-bromo-6-methylphenyl)-2-hydroxy-4-oxobutanoic acid: V115 (= V118), R328 (= R329), E418 (= E419), G443 (= G444), L445 (= L446), D446 (= D447), M499 (= M500), W525 (= W526), M615 (= M617), D617 (= D619)
- binding magnesium ion: E418 (= E419), D446 (= D447)
5cjmA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4h-thieno[3,2-b]pyrrole-5-carboxylic acid (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 8:709/711 of 5cjmA
- active site: D270 (= D261), E272 (= E263), R328 (= R329), E418 (= E419), D446 (= D447), D617 (= D619)
- binding 4h-thieno[3,2-b]pyrole-5-carboxylic acid: V117 (= V118), S274 (= S265), M499 (= M500), E616 (= E618), D617 (= D619)
- binding magnesium ion: E418 (= E419), D446 (= D447)
5drcA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-4-(1h-indol-3-yl)-4-oxobut-2-enoic acid (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 8:714/716 of 5drcA
- active site: D270 (= D261), E272 (= E263), R330 (= R329), E423 (= E419), D451 (= D447), D622 (= D619)
- binding (2Z)-2-hydroxy-4-(1H-indol-3-yl)-4-oxobut-2-enoic acid: R330 (= R329), E423 (= E419), G448 (= G444), L450 (= L446), D451 (= D447), M504 (= M500), W530 (= W526), M620 (= M617), D622 (= D619)
- binding magnesium ion: E423 (= E419), D451 (= D447), R468 (= R464), T471 (≠ E467)
5c9rA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-((4-chlorophenyl)thio)propanoic acid (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 8:715/717 of 5c9rA
- active site: D270 (= D261), E272 (= E263), R331 (= R329), E424 (= E419), D452 (= D447), D623 (= D619)
- binding 3-[(4-chlorophenyl)sulfanyl]propanoic acid: V117 (= V118), E424 (= E419), D452 (= D447), M505 (= M500), W531 (= W526), M621 (= M617), D623 (= D619)
- binding magnesium ion: E424 (= E419), D452 (= D447)
6dnpA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-3-methyl-6-f-phenyldiketoacid (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 8:710/712 of 6dnpA
- active site: D270 (= D261), E272 (= E263), R328 (= R329), E419 (= E419), D447 (= D447), D618 (= D619)
- binding (2Z)-4-(2,6-difluoro-3-methylphenyl)-2-hydroxy-4-oxobut-2-enoic acid: R328 (= R329), E419 (= E419), G444 (= G444), L446 (= L446), D447 (= D447), M500 (= M500), W526 (= W526), M616 (= M617), D618 (= D619)
- binding magnesium ion: E419 (= E419), D447 (= D447)
6bu1A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-3-oh-phenyldiketoacid (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 7:710/712 of 6bu1A
- active site: D269 (= D261), E271 (= E263), R327 (= R329), E419 (= E419), D447 (= D447), D618 (= D619)
- binding (2Z)-4-(2-bromo-3-hydroxyphenyl)-2-hydroxy-4-oxobut-2-enoic acid: V116 (= V118), R327 (= R329), E419 (= E419), G444 (= G444), L446 (= L446), D447 (= D447), M500 (= M500), W526 (= W526), M616 (= M617), D618 (= D619)
- binding magnesium ion: E419 (= E419), D447 (= D447), V463 (≠ M463), R464 (= R464)
5t8gA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-oxo-4-((thiophene-2-carbonyl)oxy)butanoic acid (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 8:712/714 of 5t8gA
- active site: D270 (= D261), E272 (= E263), R328 (= R329), E421 (= E419), D449 (= D447), D620 (= D619)
- binding (3E)-2-oxo-4-[(thiophen-2-ylcarbonyl)oxy]but-3-enoic acid: V117 (= V118), R328 (= R329), E421 (= E419), G446 (= G444), L448 (= L446), D449 (= D447), M502 (= M500), W528 (= W526), E619 (= E618), D620 (= D619)
- binding magnesium ion: E421 (= E419), D449 (= D447), R466 (= R464), T469 (≠ E467)
5dx7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-(5-chlorothiophen-2-yl)isoxazole-3-carboxylic acid (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 8:712/714 of 5dx7A
- active site: D270 (= D261), E272 (= E263), R328 (= R329), E421 (= E419), D449 (= D447), D620 (= D619)
- binding 5-(5-chlorothiophen-2-yl)-1,2-oxazole-3-carboxylic acid: V117 (= V118), M502 (= M500), M618 (= M617), D620 (= D619)
- binding magnesium ion: E421 (= E419), D449 (= D447)
5c9uA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-(2-(2,4-dichlorophenyl)hydrazinyl)-2-oxoacetic acid (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 8:712/714 of 5c9uA
- active site: D270 (= D261), E272 (= E263), R328 (= R329), E421 (= E419), D449 (= D447), D620 (= D619)
- binding [2-(2,4-dichlorophenyl)hydrazinyl](oxo)acetic acid: E421 (= E419), G446 (= G444), L448 (= L446), D449 (= D447), M502 (= M500), W528 (= W526), M618 (= M617), E619 (= E618), D620 (= D619)
- binding magnesium ion: E421 (= E419), D449 (= D447)
6ba7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-cl-4-oh-phenyldiketoacid (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 8:707/709 of 6ba7A
- active site: D268 (= D261), E270 (= E263), R329 (= R329), E419 (= E419), D447 (= D447), D618 (= D619)
- binding (2Z)-4-(2-chloro-4-hydroxyphenyl)-2-hydroxy-4-oxobut-2-enoic acid: V115 (= V118), R329 (= R329), G444 (= G444), L446 (= L446), D447 (= D447), M500 (= M500), W526 (= W526), D618 (= D619)
- binding magnesium ion: E419 (= E419), D447 (= D447)
5cbiA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-chloro-2-hydroxybenzonitrile (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 8:717/719 of 5cbiA
- active site: D270 (= D261), E272 (= E263), R331 (= R329), E426 (= E419), D454 (= D447), D625 (= D619)
- binding 5-chloro-2-hydroxybenzonitrile: L53 (= L54), N54 (≠ A55), D57 (≠ A58), F125 (= F126), Y138 (= Y139), D139 (= D140), Y142 (= Y143), M507 (= M500), W533 (= W526), P535 (= P528), A611 (≠ C605), M623 (= M617), M623 (= M617), E624 (= E618), D625 (= D619)
- binding magnesium ion: E426 (= E419), D454 (= D447)
6axbA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-naphthyldiketoacid (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 8:713/715 of 6axbA
- active site: D270 (= D261), E272 (= E263), R330 (= R329), E423 (= E419), D451 (= D447), D622 (= D619)
- binding (2Z)-2-hydroxy-4-(naphthalen-2-yl)-4-oxobut-2-enoic acid: V117 (= V118), R330 (= R329), E423 (= E419), G448 (= G444), L450 (= L446), D451 (= D447), M504 (= M500), W530 (= W526), M620 (= M617), D622 (= D619)
- binding magnesium ion: E423 (= E419), D451 (= D447)
3s9zA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4-(2-bromophenyl)-2,4-dioxobutanoic acid inhibitor (see paper)
58% identity, 99% coverage: 9:710/710 of query aligns to 8:713/715 of 3s9zA
- active site: D270 (= D261), E272 (= E263), R330 (= R329), E423 (= E419), D451 (= D447), D622 (= D619)
- binding 4-(2-bromophenyl)-2,4-dioxobutanoic acid: V117 (= V118), R330 (= R329), E423 (= E419), G448 (= G444), L450 (= L446), D451 (= D447), M504 (= M500), W530 (= W526), M620 (= M617), D622 (= D619)
- binding magnesium ion: E423 (= E419), D451 (= D447)
Query Sequence
>GFF974 FitnessBrowser__Phaeo:GFF974
MSGMQERHDMQVADTLVSFIEDKALPGTGVTADAFWAGLAGLVNGMGDENRALLAKRADL
QGQIDAWHIERKGQAHDATAYEAFLRDIGYLLPEGDDFEIETQNVDDEIANVPGPQLVVP
ITNARFALNAANARWGSLYDALYGTDAMGDLPEGKGYDAGRGARVIAWGRGFLDQTFPLA
EGSWNDCVGLSVEGGALVPALKDAAQFAGYEGDAATPGKILLKNNGLHAVIVVDANGNIG
KGDQAGINDIVLESALSTIMDCEDSVACVDGEDKVTAYANWLGLMKRDLAEEVTKGGETF
TRVLNDDQTFTAPDGSDLVLKGRSLLLVRNVGHLMTNPAVRDSAGREAGEGFIDAMVTVL
CAMHDLQAEGGNSLHGSVYVVKPKMHGPEEVAFTDRIFTHVEDALGLPRHTVKIGIMDEE
RRTSVNLKSCIRAAKHRVAFINTGFLDRTGDEIHTSMEAGAMMRKGEMKSTPWIASYEDR
NVDIGLACGLKGRAQIGKGMWAMPDRMGEMLEAKIGHPKSGATCAWVPSPTAATLHATHY
HRVNVHEVQDQLKAGGARGTLDDLLTIPVMQGENLSDAEIAQEIENNAQGILGYVVRWVD
QGVGCSKVPDIHNVGLMEDRATCRISSQALANWLHHGIVDETQVMAAMQKMAAVVDGQNA
SDASYTPMAPGFDGIAFQAACDLVFRGRIQPSGYTEPVLHARRLELKAQG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory