Comparing GFF976 FitnessBrowser__Phaeo:GFF976 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
41% identity, 99% coverage: 1:256/259 of query aligns to 6:255/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
41% identity, 98% coverage: 4:256/259 of query aligns to 4:249/249 of 7d53A
7d4rB Spua native structure (see paper)
38% identity, 94% coverage: 4:247/259 of query aligns to 2:214/215 of 7d4rB
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
35% identity, 94% coverage: 1:244/259 of query aligns to 3:243/252 of 6vtvB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
35% identity, 94% coverage: 1:244/259 of query aligns to 5:245/254 of P76038
3fijA Crystal structure of a uncharacterized protein lin1909
32% identity, 93% coverage: 3:244/259 of query aligns to 2:221/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 84% coverage: 30:247/259 of query aligns to 95:299/308 of O33341
>GFF976 FitnessBrowser__Phaeo:GFF976
MTRPKVGIIGNSYLINDEYPAHAGGTMNSEAVAEVAGCMPLLIPSDPRFLSVEELLESFD
GFLLTGGRPNVHPNEYGEAETDAHGAFDRARDAIALPLVRACVERGQPFLGICRGFQEVN
VAMGGTLYPEIRDLPGRMNHRMPPDGTLEEKFAMRHIVELTEGGVFHRLFGAAEVMTNSL
HGQGIKAPGSRIVIDGTAPDGTPEAIYVKDAPGFTLAVQWHPEWDAANDPVSRPLFTAFG
DAVRDWAEGADRPGQRKSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory