SitesBLAST
Comparing GFF977 FitnessBrowser__Phaeo:GFF977 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
29% identity, 90% coverage: 64:738/746 of query aligns to 35:718/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M67), G39 (= G68), Q40 (= Q69), H41 (≠ G70), V42 (= V71), A45 (= A74), G79 (= G142), G80 (= G143), S81 (= S144), S83 (= S146), V84 (≠ M147), G374 (= G420), F375 (= F421), L379 (≠ I425), L499 (≠ W539), R500 (= R540), V624 (≠ I644), D625 (= D645), Q632 (= Q652), T687 (≠ G707), G688 (= G708), L689 (≠ A709), G690 (= G710), E691 (= E711)
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
27% identity, 47% coverage: 218:571/746 of query aligns to 3:382/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
27% identity, 47% coverage: 218:571/746 of query aligns to 2:381/420 of 3hrdE
- active site: Q207 (= Q390), L242 (≠ I425), R318 (≠ K507), H322 (≠ D511), R350 (= R540)
- binding calcium ion: T206 (≠ N389), N208 (≠ G391), D212 (≠ V395), K241 (≠ R424), L242 (≠ I425), D243 (= D431)
- binding pterin cytosine dinucleotide: G237 (= G420), F238 (= F421), R350 (= R540)
- binding selenium atom: F238 (= F421), A348 (≠ F538), F349 (≠ W539), R350 (= R540)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
27% identity, 47% coverage: 218:571/746 of query aligns to 2:381/420 of 3hrdA
- active site: Q207 (= Q390), L242 (≠ I425), R318 (≠ K507), H322 (≠ D511), R350 (= R540)
- binding pterin cytosine dinucleotide: G236 (= G419), G237 (= G420), F238 (= F421), R350 (= R540)
- binding magnesium ion: T206 (≠ N389), N208 (≠ G391), D212 (≠ V395), K241 (≠ R424), L242 (≠ I425), D243 (= D431), T305 (≠ M497), Y308 (≠ L500), A309 (≠ P501), S346 (≠ V536)
- binding nicotinic acid: A314 (vs. gap), R318 (≠ K507), F352 (≠ V542)
- binding selenium atom: F238 (= F421), G239 (= G422), A348 (≠ F538), F349 (≠ W539), R350 (= R540)
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
28% identity, 61% coverage: 223:680/746 of query aligns to 11:518/769 of O33819
Sites not aligning to the query:
- 522:526 binding
- 650:655 binding
- 722:725 binding
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
28% identity, 61% coverage: 223:680/746 of query aligns to 3:510/761 of 1rm6A
- active site: Q206 (= Q390), T241 (≠ I425), Y318 (≠ P505), L322 (≠ H509), R350 (= R540)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G235 (= G419), G236 (= G420), F237 (= F421), G238 (= G422), R350 (= R540), I473 (≠ L640), G474 (= G641), Q475 (≠ R642), G476 (≠ P646)
Sites not aligning to the query:
- active site: 718, 719
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 513, 514, 515, 517, 518, 646, 647, 651, 654, 714, 715, 716, 717, 718
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
24% identity, 47% coverage: 223:570/746 of query aligns to 14:401/786 of 1t3qB
Sites not aligning to the query:
- active site: 743, 744
- binding pterin cytosine dinucleotide: 506, 507, 508, 510, 513, 545, 547, 549, 550, 666, 670, 674, 675, 678, 739, 740, 741, 742
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
37% identity, 17% coverage: 609:738/746 of query aligns to 603:742/748 of 5y6qC
Sites not aligning to the query:
- active site: 204, 239, 310, 316, 344
- binding pterin cytosine dinucleotide: 233, 234, 235, 461, 462, 463, 464, 468, 500, 502, 503, 504, 505
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 37% coverage: 275:549/746 of query aligns to 678:943/1361 of Q8GUQ8
- E831 (≠ R424) mutation to A: Loss of activity.
- R909 (≠ K507) mutation to A: Decreases activity 12-fold.
Sites not aligning to the query:
- 364 W→A: Decreases activity 8-fold.
- 421 Y→A: Decreases activity 4-fold.
- 1297 E→A: Decreases activity 40-fold.
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
23% identity, 39% coverage: 275:563/746 of query aligns to 627:910/1307 of 2e1qA
- active site: Q742 (= Q390), V777 (≠ I425), R855 (≠ K507), H859 (= H509), R887 (= R540)
- binding bicarbonate ion: R814 (= R461), H815 (≠ P462), I852 (≠ G504), F886 (≠ W539), F889 (≠ V542), G890 (= G543), Q893 (≠ F546)
- binding calcium ion: E715 (≠ A365), H716 (= H366), Y718 (≠ T368), T741 (≠ N389), T747 (≠ V395), S780 (≠ T427), T781 (≠ D428), S784 (≠ D431), T811 (≠ D458), G812 (≠ V459)
- binding fe2/s2 (inorganic) cluster: L719 (≠ M369)
- binding hydroxy(dioxo)molybdenum: F773 (= F421), G774 (= G422), R887 (= R540)
Sites not aligning to the query:
- active site: 1235, 1236
- binding flavin-adenine dinucleotide: 43, 44, 230, 231, 232, 233, 234, 235, 236, 237, 238, 311, 312, 316, 320, 321, 324, 325, 327, 328, 333, 334, 377, 378
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding hydroxy(dioxo)molybdenum: 1053, 1054, 1236
2ckjA Human milk xanthine oxidoreductase
23% identity, 39% coverage: 275:563/746 of query aligns to 596:879/1264 of 2ckjA
Sites not aligning to the query:
- active site: 1204, 1205
- binding flavin-adenine dinucleotide: 228, 230, 231, 232, 233, 234, 308, 309, 317, 318, 321, 322, 324, 325, 331, 375
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 147, 148
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
23% identity, 39% coverage: 275:563/746 of query aligns to 653:936/1333 of P47989
- I703 (≠ A334) to V: in dbSNP:rs17011368
- L763 (≠ I385) to F: in a breast cancer sample; somatic mutation
- R791 (≠ N413) to G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
- T910 (≠ F538) to M: in dbSNP:rs669884
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 257:264 binding
- 337 binding
- 347:351 binding
- 360 binding
- 395 K → M: in dbSNP:rs34929837
- 422 binding
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 584 D → A: in dbSNP:rs45491693
- 607 R → Q: in dbSNP:rs45442092
- 617 K → N: in dbSNP:rs45442398
- 623 T → I: in dbSNP:rs45448694
- 646 I → V: in dbSNP:rs17323225
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
24% identity, 30% coverage: 518:738/746 of query aligns to 484:719/732 of P77489
- GA 511:512 (≠ SV 541:542) binding
- 615:621 (vs. 642:648, 43% identical) binding
- Q625 (= Q652) binding
- KGVG 688:691 (≠ GGAG 707:710) binding
- E692 (= E711) mutation to Q: Loss of activity.
Sites not aligning to the query:
- 241:242 binding
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
24% identity, 30% coverage: 518:738/746 of query aligns to 484:719/731 of 5g5gC
- active site: E692 (= E711), L693 (≠ P712)
- binding pterin cytosine dinucleotide: G507 (vs. gap), Q509 (≠ F538), G511 (≠ S541), A512 (≠ V542), L617 (≠ I644), N618 (≠ D645), T621 (≠ N648), Q625 (= Q652), K688 (≠ G707), V690 (≠ A709), G691 (= G710), E692 (= E711)
Sites not aligning to the query:
- active site: 211, 246, 316, 322, 350
- binding pterin cytosine dinucleotide: 240, 241, 242, 350, 468, 469, 470
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
23% identity, 49% coverage: 211:574/746 of query aligns to 164:567/907 of 4usaA
- active site: I390 (≠ Q390), F425 (≠ I425), R501 (≠ P501), F505 (≠ H509), R533 (= R540)
- binding bicarbonate ion: R460 (= R461), A531 (≠ F538), F532 (≠ W539), Y535 (≠ V542), Q539 (≠ F546)
- binding hydrocinnamic acid: I255 (vs. gap), F425 (≠ I425), F494 (≠ A494), L497 (≠ M497), Y535 (≠ V542)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ G420), F421 (= F421), G422 (= G422), R533 (= R540)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding hydrocinnamic acid: 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
23% identity, 49% coverage: 211:574/746 of query aligns to 164:567/907 of 4us9A
- active site: I390 (≠ Q390), F425 (≠ I425), R501 (≠ P501), F505 (≠ H509), R533 (= R540)
- binding 3-phenylpropanal: I255 (vs. gap), F257 (vs. gap), P258 (vs. gap)
- binding bicarbonate ion: R460 (= R461), L498 (= L498), A531 (≠ F538), F532 (≠ W539), Y535 (≠ V542), Q539 (≠ F546)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ G420), F421 (= F421), G422 (= G422), R533 (= R540)
Sites not aligning to the query:
- active site: 869, 870
- binding 3-phenylpropanal: 752
- binding bicarbonate ion: 890, 892
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
23% identity, 49% coverage: 211:574/746 of query aligns to 164:567/907 of 4us8A
- active site: I390 (≠ Q390), F425 (≠ I425), R501 (≠ P501), F505 (≠ H509), R533 (= R540)
- binding bicarbonate ion: R460 (= R461), L498 (= L498), A531 (≠ F538), F532 (≠ W539), Y535 (≠ V542), Q539 (≠ F546)
- binding benzaldehyde: I255 (vs. gap), I255 (vs. gap), L394 (≠ V394), F425 (≠ I425), F425 (≠ I425), F425 (≠ I425), F425 (≠ I425), L497 (≠ M497), L497 (≠ M497), R501 (≠ P501), A531 (≠ F538), Y535 (≠ V542), Y535 (≠ V542)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ G420), F421 (= F421), G422 (= G422), R533 (= R540)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding benzaldehyde: 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
23% identity, 49% coverage: 211:574/746 of query aligns to 164:567/907 of 4c7yA
- active site: I390 (≠ Q390), F425 (≠ I425), R501 (≠ P501), F505 (≠ H509), R533 (= R540)
- binding bicarbonate ion: R460 (= R461), L498 (= L498), A531 (≠ F538), Y535 (≠ V542), Q539 (≠ F546)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ G420), F421 (= F421), G422 (= G422), R533 (= R540)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
23% identity, 49% coverage: 211:574/746 of query aligns to 164:567/907 of 3fc4A
- active site: I390 (≠ Q390), F425 (≠ I425), R501 (≠ P501), F505 (≠ H509), R533 (= R540)
- binding 1,2-ethanediol: Y535 (≠ V542)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G419 (= G419), T420 (≠ G420), F421 (= F421), G422 (= G422), R533 (= R540)
Sites not aligning to the query:
- active site: 869, 870
- binding 1,2-ethanediol: 622, 696, 697, 869
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
23% identity, 49% coverage: 211:574/746 of query aligns to 164:567/907 of 3fahA
- active site: I390 (≠ Q390), F425 (≠ I425), R501 (≠ P501), F505 (≠ H509), R533 (= R540)
- binding glycerol: P416 (≠ Y416), Y535 (≠ V542)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G419 (= G419), T420 (≠ G420), F421 (= F421), G422 (= G422), R533 (= R540)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding glycerol: 622, 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Query Sequence
>GFF977 FitnessBrowser__Phaeo:GFF977
MASLKKIARRSFLIGSAAIAGGVAFGTYKYHQPAPNPLAQEDGRAVLNPFVFVDQSGVTL
IAPRAEMGQGVKSAWASLIAEELDVDPAKVTVLHGPAAKAYYNSAMMSEALPGRGYDGSA
LQHSLGEIVGHMAKFLDLQVTGGSSSMRDGFERMRHAGASARETLKQAAADQLGISRDQL
TTEDGHVVAPDGTRLPYSALANAAASLAPIEADLRPASEWRLIGKDVPRIDMVAKSTGTA
EFGVDVRLPGMKFAAIRQNPHFGVGKTAFDASAAEGMAGVEKIIDLGDAVAVVASNTWLA
QQAVDAIDVTWEAAPYPETTEAIFEEIARSFDAAPNSTMRDDGDVDALPDGATVIEAEYR
LPYLAHATMEPMNATALYSGDGLQIWAPNQGPTVVQKKAAALAGLDVDAVEVNTTYLGGG
FGRRIETDYTDRAVQIAIQLQGTPVQLTWSREEDISHDVYRPGAIARYRAAIKDGKAVMV
HGKIAAQSTTVEGAGRMLGLPMSGPDKGHVDAAFNQPLAIPNFRVEGYLAKPMLPVGFWR
SVGASFNGFFSDCIIDEMAHAAGRDPLDFRLELARAEWEPAAKVLETVRDMSGWTGKTPD
GIGRGVAMAYSFGTPVAQVIEVADEDGQIRMTNAWIAADLGRVIDPKNTRAQMFGGMVYG
LSAACFGEITIDGGAVEQENFPDYDALRMHTMPTVQVELLENQPRMGGAGEPGTPPAAPA
LANALFDLTGKRARQLPLMHEFDLLI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory