SitesBLAST
Comparing GFF983 FitnessBrowser__Phaeo:GFF983 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
32% identity, 99% coverage: 3:250/250 of query aligns to 4:258/260 of 6zzqA
- active site: G17 (= G16), S142 (= S135), Y155 (= Y148)
- binding acetoacetic acid: Q94 (≠ A87), S142 (= S135), K152 (≠ A145), Y155 (= Y148), Q196 (≠ N189)
- binding nicotinamide-adenine-dinucleotide: G13 (= G12), S16 (≠ T15), G17 (= G16), I18 (= I17), D37 (≠ G36), M38 (≠ R37), D63 (= D56), V64 (= V57), N90 (= N83), A91 (= A84), G92 (= G85), M140 (≠ V133), A141 (≠ S134), S142 (= S135), Y155 (= Y148), K159 (= K152), Y187 (= Y180), V188 (= V181), T190 (= T183)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
32% identity, 99% coverage: 3:250/250 of query aligns to 5:259/261 of 6zzsD
- active site: G18 (= G16), S143 (= S135), Y156 (= Y148)
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), S17 (≠ T15), I19 (= I17), D38 (≠ G36), M39 (≠ R37), D64 (= D56), V65 (= V57), N91 (= N83), A92 (= A84), G93 (= G85), M141 (≠ V133), A142 (≠ S134), S143 (= S135), Y156 (= Y148), K160 (= K152), P186 (= P178), G187 (= G179), V189 (= V181), T191 (= T183), L193 (≠ I185)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ A87), S143 (= S135), N145 (≠ A137), K153 (≠ A145), Y156 (= Y148), Q197 (≠ N189)
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
32% identity, 99% coverage: 3:250/250 of query aligns to 2:258/260 of 5b4tA
- active site: G15 (= G16), N114 (= N107), S142 (= S135), Y155 (= Y148), K159 (= K152), I200 (= I193)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ A87), S142 (= S135), H144 (≠ A137), K152 (≠ A145), Y155 (= Y148), W187 (≠ Y180), Q196 (≠ N189)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), T13 (≠ G14), G15 (= G16), I16 (= I17), F36 (vs. gap), D63 (= D56), L64 (≠ V57), N90 (= N83), G92 (= G85), L113 (≠ T106), I140 (≠ V133), Y155 (= Y148), K159 (= K152), P185 (= P178), G186 (= G179), W187 (≠ Y180), V188 (= V181), T190 (= T183), L192 (≠ I185), V193 (≠ I186)
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
32% identity, 99% coverage: 3:250/250 of query aligns to 2:258/260 of 3w8dA
- active site: G15 (= G16), N114 (= N107), S142 (= S135), Y155 (= Y148), K159 (= K152), I200 (= I193)
- binding methylmalonic acid: Q94 (≠ A87), S142 (= S135), H144 (≠ A137), K152 (≠ A145), Y155 (= Y148), W187 (≠ Y180), Q196 (≠ N189), W257 (≠ Q249)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), T13 (≠ G14), S14 (≠ T15), G15 (= G16), I16 (= I17), F36 (vs. gap), A62 (≠ M55), D63 (= D56), L64 (≠ V57), N90 (= N83), A91 (= A84), G92 (= G85), L113 (≠ T106), S142 (= S135), Y155 (= Y148), K159 (= K152), P185 (= P178), G186 (= G179), W187 (≠ Y180), V188 (= V181), T190 (= T183), L192 (≠ I185), V193 (≠ I186)
3vdrA Crystal structure of d-3-hydroxybutyrate dehydrogenase, prepared in the presence of the substrate d-3-hydroxybutyrate and NAD(+) (see paper)
32% identity, 99% coverage: 3:250/250 of query aligns to 2:258/260 of 3vdrA
- active site: G15 (= G16), N114 (= N107), S142 (= S135), Y155 (= Y148), K159 (= K152), I200 (= I193)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ A87), H144 (≠ A137), K152 (≠ A145), Y155 (= Y148), W187 (≠ Y180), Q196 (≠ N189), W257 (≠ Q249)
- binding acetoacetic acid: Q94 (≠ A87), H144 (≠ A137), K152 (≠ A145), Y155 (= Y148), W187 (≠ Y180), Q196 (≠ N189), W257 (≠ Q249)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), T13 (≠ G14), I16 (= I17), F36 (vs. gap), D63 (= D56), L64 (≠ V57), N90 (= N83), A91 (= A84), G92 (= G85), L113 (≠ T106), K159 (= K152), G186 (= G179), V188 (= V181), T190 (= T183), L192 (≠ I185), V193 (≠ I186)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G12), T13 (≠ G14), I16 (= I17), F36 (vs. gap), D63 (= D56), L64 (≠ V57), N90 (= N83), A91 (= A84), G92 (= G85), L113 (≠ T106), S142 (= S135), Y155 (= Y148), K159 (= K152), G186 (= G179), V188 (= V181), T190 (= T183), L192 (≠ I185), V193 (≠ I186)
3vdqA Crystal structure of alcaligenes faecalis d-3-hydroxybutyrate dehydrogenase in complex with NAD(+) and acetate (see paper)
32% identity, 99% coverage: 3:250/250 of query aligns to 2:258/260 of 3vdqA
- active site: G15 (= G16), N114 (= N107), S142 (= S135), Y155 (= Y148), K159 (= K152), I200 (= I193)
- binding acetate ion: Q94 (≠ A87), H144 (≠ A137), K152 (≠ A145), W187 (≠ Y180), L192 (≠ I185), Q196 (≠ N189)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), S14 (≠ T15), I16 (= I17), F36 (vs. gap), D63 (= D56), L64 (≠ V57), N90 (= N83), A91 (= A84), G92 (= G85), L113 (≠ T106), I140 (≠ V133), S142 (= S135), Y155 (= Y148), K159 (= K152), P185 (= P178), G186 (= G179), W187 (≠ Y180), V188 (= V181), T190 (= T183), L192 (≠ I185), V193 (≠ I186)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
32% identity, 99% coverage: 2:248/250 of query aligns to 1:251/255 of 2q2qD
- active site: G15 (= G16), S138 (= S135), Y151 (= Y148), K155 (= K152), R196 (≠ I193)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), T13 (≠ G14), S14 (≠ T15), G15 (= G16), I16 (= I17), F36 (vs. gap), D59 (= D56), L60 (≠ V57), N86 (= N83), G88 (= G85), L109 (≠ T106), I136 (≠ V133), S138 (= S135), Y151 (= Y148), K155 (= K152), P181 (= P178), G182 (= G179), W183 (≠ Y180), V184 (= V181), T186 (= T183), L188 (≠ I185), V189 (≠ I186)
1xr3A Actinorhodin polyketide ketoreductase with NADP and the inhibitor isoniazid bound (see paper)
33% identity, 96% coverage: 8:248/250 of query aligns to 4:252/256 of 1xr3A
- active site: G12 (= G16), N109 (= N107), S139 (= S135), Y152 (= Y148), K156 (= K152), Y197 (≠ I193)
- binding 4-(diazenylcarbonyl)pyridine: T140 (≠ I136), G141 (≠ A137), V146 (≠ L142)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), T10 (≠ G14), S11 (≠ T15), G12 (= G16), I13 (= I17), A32 (≠ G36), R33 (= R37), G34 (≠ R38), C57 (≠ M55), D58 (= D56), V59 (= V57), N85 (= N83), A86 (= A84), G87 (= G85), S139 (= S135), Y152 (= Y148), K156 (= K152), G183 (= G179), V185 (= V181), T187 (= T183), P188 (= P184)
2rh4A Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
33% identity, 96% coverage: 8:248/250 of query aligns to 5:253/257 of 2rh4A
- active site: G13 (= G16), N110 (= N107), S140 (= S135), Y153 (= Y148), K157 (= K152), Y198 (≠ I193)
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: T141 (≠ I136), Q145 (≠ R140), V147 (≠ L142), Y153 (= Y148), F185 (≠ Y180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G12), T11 (≠ G14), S12 (≠ T15), G13 (= G16), I14 (= I17), A33 (≠ G36), R34 (= R37), G35 (≠ R38), C58 (≠ M55), D59 (= D56), V60 (= V57), N86 (= N83), G88 (= G85), S140 (= S135), Y153 (= Y148), K157 (= K152), P183 (= P178), G184 (= G179), V186 (= V181), T188 (= T183), M190 (≠ I185)
Sites not aligning to the query:
1w4zA Structure of actinorhodin polyketide (actiii) reductase (see paper)
33% identity, 96% coverage: 8:248/250 of query aligns to 7:255/259 of 1w4zA
- active site: G15 (= G16), N112 (= N107), S142 (= S135), Y155 (= Y148), K159 (= K152), Y200 (≠ I193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), T13 (≠ G14), S14 (≠ T15), G15 (= G16), I16 (= I17), R36 (= R37), G37 (≠ R38), D61 (= D56), V62 (= V57), N88 (= N83), G90 (= G85), S142 (= S135), Y155 (= Y148), K159 (= K152), P185 (= P178), G186 (= G179), V188 (= V181), T190 (= T183)
2rh4B Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
33% identity, 96% coverage: 8:248/250 of query aligns to 16:264/268 of 2rh4B
- active site: G24 (= G16), N121 (= N107), S151 (= S135), Y164 (= Y148), K168 (= K152), Y209 (≠ I193)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G12), T22 (≠ G14), S23 (≠ T15), I25 (= I17), A44 (≠ G36), R45 (= R37), G46 (≠ R38), C69 (≠ M55), D70 (= D56), V71 (= V57), N97 (= N83), S151 (= S135), Y164 (= Y148), K168 (= K152), G195 (= G179), V197 (= V181), T199 (= T183), M201 (≠ I185)
P16544 Putative ketoacyl reductase; EC 1.3.1.- from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
33% identity, 96% coverage: 8:248/250 of query aligns to 9:257/261 of P16544
- 11:39 (vs. 10:38, 41% identical) binding
- D63 (= D56) binding
- K161 (= K152) binding
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
30% identity, 99% coverage: 2:248/250 of query aligns to 1:251/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), T13 (≠ G14), S14 (≠ T15), G15 (= G16), I16 (= I17), G35 (= G36), F36 (vs. gap), L60 (≠ V57), N86 (= N83), G88 (= G85), I89 (= I86), A137 (≠ S134), Y151 (= Y148), K155 (= K152), P181 (= P178), G182 (= G179), V184 (= V181), T186 (= T183)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
31% identity, 99% coverage: 3:250/250 of query aligns to 2:258/260 of 2ztlA
- active site: G15 (= G16), N114 (= N107), S142 (= S135), Y155 (= Y148), K159 (= K152), L200 (≠ I193)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ A87), S142 (= S135), H144 (≠ A137), K152 (≠ A145), Y155 (= Y148), Q196 (≠ N189)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), G15 (= G16), I16 (= I17), F36 (≠ R37), L64 (vs. gap), N90 (= N83), A91 (= A84), G92 (= G85), L113 (≠ T106), Y155 (= Y148), K159 (= K152), P185 (= P178), W187 (≠ Y180), V188 (= V181), T190 (= T183), V193 (≠ I186)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
31% identity, 99% coverage: 3:250/250 of query aligns to 2:258/260 of 1wmbA
3sjuA Hedamycin polyketide ketoreductase bound to NADPH (see paper)
33% identity, 96% coverage: 8:248/250 of query aligns to 3:251/255 of 3sjuA
- active site: G11 (= G16), S138 (= S135), Y151 (= Y148), K155 (= K152), Y196 (≠ I193)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G12), S10 (≠ T15), A31 (≠ G36), R32 (= R37), D33 (≠ R38), C56 (≠ D62), D57 (≠ V63), V58 (≠ I64), S84 (≠ N83), A85 (= A84), G86 (= G85), I136 (≠ V133), Y151 (= Y148), K155 (= K152), P181 (= P178), G182 (= G179), Y183 (= Y180), V184 (= V181), T186 (= T183), M188 (≠ I185)
1uznA Maba from mycobacterium tuberculosis (see paper)
33% identity, 97% coverage: 6:248/250 of query aligns to 8:234/239 of 1uznA
- active site: G18 (= G16), S132 (= S135), Y145 (= Y148), K149 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G12), N16 (≠ G14), R17 (≠ T15), I19 (= I17), R39 (= R37), D53 (= D56), V54 (= V57), A81 (= A84), G82 (= G85)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
34% identity, 99% coverage: 3:250/250 of query aligns to 4:247/249 of 4bmsF
- active site: S137 (= S135), H147 (≠ A145), Y150 (= Y148), K154 (= K152), Q195 (≠ V199)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), N15 (≠ G14), S16 (≠ T15), I18 (= I17), R38 (= R37), R39 (= R38), A59 (≠ M55), D60 (= D56), V61 (= V57), N87 (= N83), S88 (≠ A84), G89 (= G85), V110 (≠ T106), S137 (= S135), Y150 (= Y148), K154 (= K152), G181 (= G179), I183 (≠ V181), T185 (= T183), I187 (= I185)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
31% identity, 100% coverage: 1:250/250 of query aligns to 3:253/255 of 5itvA
- active site: G18 (= G16), S141 (= S135), Y154 (= Y148), K158 (= K152)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), S17 (≠ T15), G18 (= G16), I19 (= I17), D38 (vs. gap), I39 (vs. gap), T61 (≠ M55), I63 (≠ V57), N89 (= N83), G91 (= G85), T139 (≠ V133), S141 (= S135), Y154 (= Y148), K158 (= K152), P184 (= P178), G185 (= G179), I186 (≠ Y180), I187 (≠ V181)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
34% identity, 99% coverage: 3:250/250 of query aligns to 4:247/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S135), H147 (≠ A145), Y150 (= Y148), L188 (≠ I186), L246 (≠ Q249)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), N15 (≠ G14), S16 (≠ T15), G17 (= G16), I18 (= I17), R38 (= R37), R39 (= R38), D60 (= D56), V61 (= V57), N87 (= N83), S88 (≠ A84), G89 (= G85), V110 (≠ T106), T135 (≠ V133), S137 (= S135), Y150 (= Y148), K154 (= K152), P180 (= P178), G181 (= G179), A182 (≠ Y180), I183 (≠ V181), T185 (= T183), S187 (≠ I185)
Query Sequence
>GFF983 FitnessBrowser__Phaeo:GFF983
MTLKGKHALITGGGTGIGLAMAQALAAEGAEVTITGRRQEVLEEVATEGLHPLAMDVRDE
ADVIAKIDAATAARGPIQICVPNAGIAEGKALHKMSMEFWRNMMATNLDGAFLTIRESMK
SMRQTDWGRVMTVSSIAGLRGLQGAPCYSASKHGLIGLTRSLSEDYLGTPYTFNALCPGY
VDTPIIDRNVTSISQRAGVSEEDALKIMVSANRHKRLILPDEVAAALLWLCGPGSQSING
QTIEIAGGQT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory