Comparing GFF993 FitnessBrowser__psRCH2:GFF993 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
40% identity, 98% coverage: 2:251/255 of query aligns to 12:261/265 of P07821
5x40A Structure of a cbio dimer bound with amppcp (see paper)
40% identity, 84% coverage: 12:226/255 of query aligns to 16:228/280 of 5x40A
Sites not aligning to the query:
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
36% identity, 94% coverage: 15:254/255 of query aligns to 13:246/248 of 4fi3C
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
37% identity, 87% coverage: 15:237/255 of query aligns to 13:231/231 of 1l7vC
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 84% coverage: 13:226/255 of query aligns to 17:229/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 84% coverage: 13:226/255 of query aligns to 18:230/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 84% coverage: 13:226/255 of query aligns to 18:230/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 84% coverage: 13:226/255 of query aligns to 18:230/344 of 6cvlD
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 85% coverage: 20:235/255 of query aligns to 21:233/240 of 6mjpA
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
35% identity, 80% coverage: 12:214/255 of query aligns to 13:213/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
35% identity, 80% coverage: 12:214/255 of query aligns to 13:213/219 of 8w6iD
Sites not aligning to the query:
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
35% identity, 80% coverage: 12:214/255 of query aligns to 330:528/865 of O65934
Sites not aligning to the query:
3nh9A Nucleotide binding domain of human abcb6 (atp bound structure) (see paper)
34% identity, 78% coverage: 16:215/255 of query aligns to 50:246/273 of 3nh9A
Sites not aligning to the query:
3nhaA Nucleotide binding domain of human abcb6 (adp mg bound structure) (see paper)
34% identity, 78% coverage: 16:215/255 of query aligns to 55:251/278 of 3nhaA
Sites not aligning to the query:
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
34% identity, 80% coverage: 12:214/255 of query aligns to 13:213/218 of 8hd0A
Sites not aligning to the query:
6tejB Structure of apo irtab devoid sid in complex with sybody syb_nl5 (see paper)
31% identity, 88% coverage: 5:228/255 of query aligns to 334:554/585 of 6tejB
7dnzB Cryo-em structure of the human abcb6 (hemin and gsh-bound) (see paper)
33% identity, 80% coverage: 16:220/255 of query aligns to 370:571/591 of 7dnzB
Sites not aligning to the query:
7dnzA Cryo-em structure of the human abcb6 (hemin and gsh-bound) (see paper)
33% identity, 80% coverage: 16:220/255 of query aligns to 370:571/591 of 7dnzA
Sites not aligning to the query:
8k7bA Post-occluded structure of human abcb6 w546a mutant (adp/vo4-bound) (see paper)
33% identity, 80% coverage: 16:220/255 of query aligns to 368:569/590 of 8k7bA
Sites not aligning to the query:
7dnyB Cryo-em structure of the human abcb6 (coproporphyrin iii-bound) (see paper)
33% identity, 80% coverage: 16:220/255 of query aligns to 352:553/575 of 7dnyB
Sites not aligning to the query:
>GFF993 FitnessBrowser__psRCH2:GFF993
MLAGNDLTVRRGSITALQGVSLQLRAGQVFGVLGPNGAGKSTLLAALSGELRPSAGHVLL
QGRALADWPDVERARCLAVLPQSSTLNFAFRVADVVAMGRLPHRTGGRADAAIVEAALAA
ADAQHLAARSYLKLSGGERQRVHLARVLAQLWPGGPGRVLLLDEPTSMLDPAHQHSILQT
VRGFAAQGGAALVILHDLNLAARYCDRLLLLKNGCPQAEGSVDEVLRAEQLQAVFGLEVL
VQRHPERGHPLIIAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory