Comparing Ga0059261_0067 Ga0059261_0067 acetolactate synthase, small subunit (EC 2.2.1.6) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
2pc6A Crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea (see paper)
46% identity, 93% coverage: 10:168/171 of query aligns to 3:159/164 of 2pc6A
A0QUX7 Acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
43% identity, 92% coverage: 11:167/171 of query aligns to 8:162/170 of A0QUX7
Q9FFF4 Acetolactate synthase small subunit 2, chloroplastic; ALS-interacting protein 3; Acetohydroxy-acid synthase small subunit 2; Protein valine-tolerant 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
44% identity, 95% coverage: 6:168/171 of query aligns to 72:230/477 of Q9FFF4
Sites not aligning to the query:
P9WKJ3 Putative acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
43% identity, 92% coverage: 11:167/171 of query aligns to 6:160/168 of P9WKJ3
Q93YZ7 Acetolactate synthase small subunit 1, chloroplastic; ALS-interacting protein 1; Acetohydroxyacid synthase small subunit 1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
41% identity, 91% coverage: 11:166/171 of query aligns to 320:473/491 of Q93YZ7
Sites not aligning to the query:
6vz8G Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
41% identity, 91% coverage: 11:166/171 of query aligns to 4:157/159 of 6vz8G
6vz8F Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
42% identity, 95% coverage: 7:168/171 of query aligns to 1:158/159 of 6vz8F
6wo1B Hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit (see paper)
33% identity, 92% coverage: 9:166/171 of query aligns to 3:195/197 of 6wo1B
O60086 Probable acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 96% coverage: 6:170/171 of query aligns to 66:268/289 of O60086
Sites not aligning to the query:
6u9dL Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
30% identity, 94% coverage: 6:166/171 of query aligns to 33:240/255 of 6u9dL
5yumA Crystallographic structures of ilvn.Val/ile complexes:conformational selectivity for feedback inhibition of ahass (see paper)
34% identity, 41% coverage: 13:82/171 of query aligns to 6:73/91 of 5yumA
5yppE Crystal structure of ilvn.Val-1a (see paper)
34% identity, 41% coverage: 13:82/171 of query aligns to 6:73/91 of 5yppE
>Ga0059261_0067 Ga0059261_0067 acetolactate synthase, small subunit (EC 2.2.1.6)
MHIKEEKAERHTLAVIVDNEPGILARIAGLFTARGYNIESLTVSEITEDKAVSRITIVTS
ASPATLEQIVAQLDRLVPVHKVHDLTAEGEHVERELALVKVAGTGDHRIEALRLSEVYRA
RVVDATISSFVFEVTGTTEKIDKFIELMGEVGLIEVARTGIVAISRGKEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory