SitesBLAST
Comparing Ga0059261_0156 FitnessBrowser__Korea:Ga0059261_0156 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ykgA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with NAD+ from escherichia coli (see paper)
62% identity, 98% coverage: 1:514/525 of query aligns to 1:517/521 of 4ykgA
- active site: C345 (= C343), C348 (= C346), D349 (= D347)
- binding flavin-adenine dinucleotide: G221 (= G219), P222 (= P220), A223 (= A221), G242 (≠ A240), E243 (= E241), G247 (= G245), Q248 (= Q246), T252 (= T250), N257 (= N255), S289 (≠ R287), A290 (= A288), T322 (= T320), G323 (= G321), C348 (= C346), G487 (= G484), D488 (= D485), Q496 (= Q493), I497 (= I494)
- binding nicotinamide-adenine-dinucleotide: I361 (= I359), G364 (= G362), S366 (= S364), E385 (= E383), F386 (≠ Y384), I449 (= I446), M467 (≠ R464), P493 (= P490)
4ykfA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with nadh from escherichia coli (see paper)
62% identity, 98% coverage: 1:514/525 of query aligns to 1:517/521 of 4ykfA
- active site: C345 (= C343), C348 (= C346), D349 (= D347)
- binding flavin-adenine dinucleotide: G221 (= G219), P222 (= P220), A223 (= A221), G242 (≠ A240), E243 (= E241), G247 (= G245), Q248 (= Q246), N257 (= N255), A290 (= A288), T322 (= T320), G323 (= G321), C348 (= C346), N454 (= N451), D488 (= D485), Q496 (= Q493), I497 (= I494)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I361 (= I359), G364 (= G362), N365 (= N363), S366 (= S364), E385 (= E383), F386 (≠ Y384), K391 (≠ R389), I449 (= I446), M467 (≠ R464)
P35340 Alkyl hydroperoxide reductase subunit F; Alkyl hydroperoxide reductase F52A protein; EC 1.8.1.- from Escherichia coli (strain K12) (see paper)
62% identity, 98% coverage: 1:514/525 of query aligns to 1:517/521 of P35340
- K53 (≠ R54) modified: N6-acetyllysine
- K354 (= K352) modified: N6-acetyllysine
1hyuA Crystal structure of intact ahpf (see paper)
62% identity, 98% coverage: 1:514/525 of query aligns to 1:517/521 of 1hyuA
- binding flavin-adenine dinucleotide: G221 (= G219), P222 (= P220), A223 (= A221), E243 (= E241), G247 (= G245), Q248 (= Q246), N257 (= N255), S289 (≠ R287), A290 (= A288), T322 (= T320), G323 (= G321), W326 (= W324), C345 (= C343), D488 (= D485), K495 (= K492), Q496 (= Q493), I497 (= I494)
3ctyB Crystal structure of t. Acidophilum thioredoxin reductase (see paper)
39% identity, 57% coverage: 211:509/525 of query aligns to 5:300/305 of 3ctyB
- active site: A38 (vs. gap), T42 (≠ V247), L47 (≠ G252), N50 (= N255), C133 (= C343), C136 (= C346), D137 (= D347)
- binding flavin-adenine dinucleotide: V10 (= V216), G11 (= G217), A15 (= A221), D34 (≠ A240), K35 (≠ E241), G40 (= G245), L41 (≠ Q246), T42 (≠ V247), A45 (≠ T250), P46 (≠ M251), N50 (= N255), V82 (≠ I282), T110 (= T320), G111 (= G321), S154 (= S364), Q241 (≠ N451), G275 (= G484), D276 (= D485), A283 (≠ K492), Q284 (= Q493), I285 (= I494)
7jypA Structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b
37% identity, 57% coverage: 208:504/525 of query aligns to 3:296/305 of 7jypA
- binding flavin-adenine dinucleotide: G12 (= G217), G14 (= G219), P15 (= P220), A16 (= A221), F34 (≠ A239), E35 (≠ A240), K36 (≠ E241), G41 (= G245), A42 (≠ Q246), V83 (≠ L291), T112 (= T320), G113 (= G321), G276 (= G484), D277 (= D485)
- binding nicotinamide-adenine-dinucleotide: G153 (= G361), G154 (= G362), S156 (= S364), Q175 (≠ E383), N176 (≠ Y384), T181 (≠ R389), V238 (≠ I446)
7aawA Thioredoxin reductase from bacillus cereus (see paper)
36% identity, 59% coverage: 211:518/525 of query aligns to 7:311/315 of 7aawA
- binding flavin-adenine dinucleotide: G13 (= G217), G15 (= G219), P16 (= P220), A17 (= A221), E36 (= E241), R37 (= R242), G42 (= G245), Q43 (= Q246), T47 (= T250), N52 (= N255), G82 (≠ K290), V84 (≠ I292), A111 (≠ S319), S112 (≠ T320), G113 (= G321), C138 (= C346), G277 (= G484), D278 (= D485), Q286 (= Q493), I287 (= I494)
- binding alpha-D-glucopyranose: R27 (= R231), D49 (≠ G252), K74 (≠ E277), F75 (≠ M283), P122 (= P330), G123 (= G331), E126 (= E334), G129 (≠ N337), G131 (= G339), V132 (= V340), F143 (= F351), E206 (≠ R414), N208 (≠ S416)
7aawB Thioredoxin reductase from bacillus cereus (see paper)
36% identity, 59% coverage: 211:518/525 of query aligns to 4:308/311 of 7aawB
- binding flavin-adenine dinucleotide: G10 (= G217), G12 (= G219), P13 (= P220), A14 (= A221), E33 (= E241), R34 (= R242), G39 (= G245), Q40 (= Q246), T44 (= T250), N49 (= N255), G79 (≠ K290), D80 (≠ L291), V81 (≠ I292), S109 (≠ T320), G110 (= G321), Y113 (≠ W324), C135 (= C346), G274 (= G484), D275 (= D485), Q283 (= Q493), I284 (= I494)
- binding alpha-D-glucopyranose: D46 (≠ G252), E48 (= E254), G126 (≠ N337), G128 (= G339), D136 (= D347), A138 (≠ P349), F139 (≠ L350), F139 (≠ L350), F140 (= F351)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G361), G151 (= G362), D152 (≠ N363), S153 (= S364), E156 (= E367), H172 (≠ E383), R173 (≠ Y384), R174 (≠ D385), R178 (= R389), I236 (= I446)
5uwyA The crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005
34% identity, 58% coverage: 211:512/525 of query aligns to 5:303/306 of 5uwyA
- binding flavin-adenine dinucleotide: G13 (= G219), P14 (= P220), A15 (= A221), E34 (≠ A240), Q35 (≠ E241), G40 (= G245), Q41 (= Q246), T45 (= T250), N50 (= N255), V82 (≠ I292), T110 (= T320), G111 (= G321), Y114 (≠ W324), C136 (= C346), V242 (≠ N451), G275 (= G484), D276 (= D485), Q284 (= Q493), I285 (= I494)
3f8pD Structure of sulfolobus solfataricus trxr-b3 (see paper)
33% identity, 58% coverage: 209:512/525 of query aligns to 5:307/310 of 3f8pD
- active site: C135 (= C343), C138 (= C346), D139 (= D347)
- binding nicotinamide-adenine-dinucleotide: V12 (= V216), G13 (= G217), L14 (≠ G218), G15 (= G219), P16 (= P220), A17 (= A221), G36 (≠ A240), T38 (≠ R242), G41 (= G245), Q42 (= Q246), I82 (≠ R287), V83 (≠ A288), G111 (≠ S319), I112 (≠ T320), G113 (= G321), G277 (= G484), D278 (= D485)
2q7vA Crystal structure of deinococcus radiodurans thioredoxin reductase (see paper)
34% identity, 56% coverage: 211:506/525 of query aligns to 8:304/313 of 2q7vA
- active site: P41 (vs. gap), I45 (≠ V247), E50 (≠ G252), C141 (= C343), C144 (= C346), D145 (= D347)
- binding flavin-adenine dinucleotide: G16 (= G219), P17 (= P220), A18 (= A221), E37 (≠ A240), K38 (≠ E241), G43 (= G245), Q44 (= Q246), I45 (≠ V247), N53 (= N255), E85 (≠ N284), V86 (≠ L285), T118 (= T320), G119 (= G321), C144 (= C346), G282 (= G484), D283 (= D485), Q291 (= Q493), L292 (≠ I494), S295 (≠ A497)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
36% identity, 57% coverage: 212:512/525 of query aligns to 16:315/335 of P9WHH1
- SGPA 22:25 (≠ GGPA 218:221) binding
- Y32 (= Y228) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 239:246, 38% identical) binding
- N60 (= N255) binding
- V93 (≠ L291) binding
- C145 (= C343) modified: Disulfide link with 148, Redox-active
- C148 (= C346) modified: Disulfide link with 145, Redox-active
- S166 (= S364) binding
- H185 (≠ E383) binding
- R191 (= R389) binding
- I248 (= I446) binding
- Y268 (≠ E466) binding
- D288 (= D485) binding
- R295 (≠ K492) binding
- RQAV 295:298 (≠ KQIV 492:495) binding
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
36% identity, 57% coverage: 212:512/525 of query aligns to 7:306/313 of 2a87A
- active site: F39 (= F243), L43 (≠ V247), D48 (≠ G252), C136 (= C343), C139 (= C346), D140 (= D347)
- binding flavin-adenine dinucleotide: G12 (= G217), S13 (≠ G218), G14 (= G219), P15 (= P220), A16 (= A221), F34 (vs. gap), E35 (≠ A239), G36 (≠ A240), G40 (= G244), G41 (= G245), A42 (≠ Q246), L43 (≠ V247), T46 (= T250), V49 (≠ I253), N51 (= N255), D83 (≠ K290), V84 (≠ L291), M113 (≠ T320), C139 (= C346), G278 (= G484), D279 (= D485), R286 (≠ K492), Q287 (= Q493), A288 (≠ I494), V289 (= V495)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (≠ M327), G155 (= G362), D156 (≠ N363), S157 (= S364), H176 (≠ E383), R177 (≠ Y384), R178 (≠ D385), R182 (= R389), I239 (= I446), Y259 (≠ E466), R283 (≠ V489), R286 (≠ K492)
3f8rA Crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two NADP molecules (see paper)
33% identity, 58% coverage: 209:512/525 of query aligns to 5:305/308 of 3f8rA
- active site: C133 (= C343), C136 (= C346), D137 (= D347)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V12 (= V216), G13 (= G217), L14 (≠ G218), G15 (= G219), P16 (= P220), A17 (= A221), E37 (= E241), T38 (≠ R242), G41 (= G245), Q42 (= Q246), I82 (≠ R287), V83 (≠ A288), G109 (≠ S319), I110 (≠ T320), G111 (= G321), R115 (= R325), L117 (≠ M327), D153 (≠ N363), S154 (= S364), E157 (= E367), R174 (≠ Y384), R175 (≠ D385), Y184 (≠ L394), I236 (= I446), G275 (= G484), D276 (= D485), L282 (≠ V489), G283 (≠ P490), R285 (≠ K492)
4gcmB Crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. Aureus mu50 at 1.80 a resolution
36% identity, 58% coverage: 211:515/525 of query aligns to 5:306/309 of 4gcmB
- active site: C133 (= C343), C136 (= C346), D137 (= D347)
- binding flavin-adenine dinucleotide: G11 (= G217), G13 (= G219), P14 (= P220), A15 (= A221), E34 (= E241), R35 (= R242), G40 (= G245), Q41 (= Q246), T45 (= T250), N50 (= N255), D81 (≠ L291), I82 (= I292), T110 (= T320), G111 (= G321), C136 (= C346), G275 (= G484), D276 (= D485), Q284 (= Q493), I285 (= I494)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I117 (≠ M327), G151 (= G361), G152 (= G362), D153 (≠ N363), S154 (= S364), E157 (= E367), R174 (≠ Y384), R175 (≠ D385), R179 (= R389), Q181 (≠ D391), I237 (= I446)
3f8dA Structure of sulfolobus solfataricus thioredoxin reductase mutant c147a (see paper)
32% identity, 58% coverage: 209:512/525 of query aligns to 5:305/308 of 3f8dA
- active site: C133 (= C343), A136 (≠ C346), D137 (= D347)
- binding flavin-adenine dinucleotide: V12 (= V216), G13 (= G217), L14 (≠ G218), G15 (= G219), P16 (= P220), A17 (= A221), G36 (≠ A240), E37 (= E241), T38 (≠ R242), G41 (= G245), Q42 (= Q246), E45 (≠ D249), A46 (≠ T250), V49 (≠ I253), D51 (≠ N255), I82 (≠ R287), V83 (≠ A288), G109 (≠ S319), I110 (≠ T320), G111 (= G321), C133 (= C343), A136 (≠ C346), G275 (= G484), D276 (= D485), R285 (≠ K492), Q286 (= Q493), V287 (≠ I494)
5mh4A Crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) (see paper)
31% identity, 58% coverage: 211:515/525 of query aligns to 2:303/303 of 5mh4A
- active site: V34 (vs. gap), P35 (vs. gap), M39 (≠ V247), E44 (≠ G252), C130 (= C343), C133 (= C346), D134 (= D347)
- binding flavin-adenine dinucleotide: G10 (= G219), P11 (= P220), A12 (= A221), E31 (= E241), R32 (= R242), G37 (= G245), Q38 (= Q246), T42 (= T250), N47 (= N255), G77 (≠ K290), V79 (≠ I292), T107 (= T320), G108 (= G321), E155 (≠ A368), V239 (≠ N451), F242 (≠ W454), G272 (= G484), D273 (= D485), Q281 (= Q493), I282 (= I494)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I146 (= I359), G147 (= G360), G148 (= G361), G149 (= G362), D150 (≠ N363), S151 (= S364), E154 (= E367), H170 (≠ E383), R171 (≠ Y384), R172 (≠ D385), R176 (= R389), V234 (≠ I446), G235 (= G447), R280 (≠ K492), Q281 (= Q493)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
34% identity, 57% coverage: 212:512/525 of query aligns to 4:302/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ V216), G9 (= G217), S10 (≠ G218), G11 (= G219), P12 (= P220), A13 (= A221), E32 (≠ A239), G33 (≠ A240), Q35 (≠ R242), G38 (= G245), A39 (≠ Q246), L40 (≠ V247), T43 (= T250), N48 (= N255), D80 (≠ K290), V81 (≠ L291), M109 (≠ T320), G110 (= G321), T131 (≠ Y342), C135 (= C346), G274 (= G484), D275 (= D485), R282 (≠ K492), Q283 (= Q493), A284 (≠ I494), A287 (= A497)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (= R325), H115 (≠ Q326), L116 (≠ M327), R173 (≠ Y384), E200 (≠ L411), I201 (≠ T412), I235 (= I446)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
34% identity, 57% coverage: 212:512/525 of query aligns to 4:302/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ V216), G9 (= G217), S10 (≠ G218), G11 (= G219), P12 (= P220), A13 (= A221), E32 (≠ A239), G33 (≠ A240), Q35 (≠ R242), G38 (= G245), A39 (≠ Q246), L40 (≠ V247), T43 (= T250), N48 (= N255), D80 (≠ K290), V81 (≠ L291), M109 (≠ T320), G110 (= G321), T131 (≠ Y342), C135 (= C346), G274 (= G484), D275 (= D485), R282 (≠ K492), Q283 (= Q493), A284 (≠ I494), A287 (= A497)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (≠ M327), R173 (≠ Y384), E200 (≠ L411), I201 (≠ T412)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
34% identity, 57% coverage: 212:512/525 of query aligns to 4:302/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G217), S10 (≠ G218), G11 (= G219), P12 (= P220), A13 (= A221), E32 (≠ A239), G33 (≠ A240), Q35 (≠ R242), G38 (= G245), A39 (≠ Q246), L40 (≠ V247), T43 (= T250), N48 (= N255), D80 (≠ K290), V81 (≠ L291), M109 (≠ T320), G110 (= G321), T131 (≠ Y342), C135 (= C346), G274 (= G484), D275 (= D485), R282 (≠ K492), Q283 (= Q493), A284 (≠ I494), A287 (= A497)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (= R325), H115 (≠ Q326), L116 (≠ M327), V148 (≠ I359), R173 (≠ Y384), E200 (≠ L411), I201 (≠ T412)
Query Sequence
>Ga0059261_0156 FitnessBrowser__Korea:Ga0059261_0156
MLDAHLKQQLEGYLVNIREPIELVASLGDDAKSRELETLLTEIADLSGKIALVRADDKRK
PSFMIRRAGTDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKAAQDVIEQVKGLEGELHFE
TYFSLSCQNCPDVVQALNLMAVLNPQISHVAIDGALFKAEVDARQVLAVPTVFLNGEPFG
SGRMELEQIVAKLDSGADAKAAAKLEAKEPFDVLVVGGGPAGAASAIYTARKGLRVGVAA
ERFGGQVLDTMGIENFISVPYTEGPKLAAQLESHVKENEVDIMNLQRAEKLIPASHEGGL
HEVVLANGATLKAKTVILSTGARWRQMGVPGENEYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLIEYDSQLRADAVLQRKLASLPNVRIITSALTTRVSGAEK
VTGLTYKDRNSGEEHDIELEGIFVQIGLVPNTEWLKDAIALTPRGEIEIDARGETSQPGI
FAAGDATTVPYKQIVIAMGAGSTAALSAFDYLIRLPAEEIEAAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory