SitesBLAST
Comparing Ga0059261_0167 FitnessBrowser__Korea:Ga0059261_0167 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
59% identity, 95% coverage: 17:439/443 of query aligns to 18:443/455 of Q9R4E4
- KS 28:29 (= KS 27:28) binding
- R33 (= R32) binding
- NAAT 98:101 (≠ NSGT 98:101) Phosphoenolpyruvate
- A100 (≠ G100) mutation to G: Confers resistance to glyphosate.
- R128 (= R128) binding
- K353 (= K352) binding
- R357 (= R356) binding
- R405 (= R401) binding
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
59% identity, 95% coverage: 17:439/443 of query aligns to 13:438/445 of 2pqcA
- active site: K23 (= K27), S24 (= S28), D50 (= D54), N93 (= N98), R123 (= R128), D321 (= D325), E349 (= E353), H399 (= H400), R400 (= R401), T426 (= T427)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K27), S24 (= S28), R28 (= R32), T96 (= T101), R123 (= R128), S168 (= S173), Q170 (= Q175), D321 (= D325), K348 (= K352), E349 (= E353), R352 (= R356), R400 (= R401)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
59% identity, 95% coverage: 17:439/443 of query aligns to 13:438/445 of 2pqbA
- active site: K23 (= K27), S24 (= S28), D50 (= D54), N93 (= N98), R123 (= R128), D321 (= D325), E349 (= E353), H399 (= H400), R400 (= R401), T426 (= T427)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K27), S24 (= S28), R28 (= R32), A95 (≠ G100), T96 (= T101), R123 (= R128), S168 (= S173), Q170 (= Q175), D321 (= D325), K348 (= K352), E349 (= E353), R352 (= R356), R400 (= R401)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
59% identity, 95% coverage: 17:439/443 of query aligns to 13:438/445 of 2ggaA
- active site: K23 (= K27), S24 (= S28), D50 (= D54), N93 (= N98), R123 (= R128), D321 (= D325), E349 (= E353), H399 (= H400), R400 (= R401), T426 (= T427)
- binding glyphosate: K23 (= K27), A94 (≠ S99), A95 (≠ G100), T96 (= T101), R123 (= R128), D321 (= D325), E349 (= E353), R352 (= R356), R400 (= R401)
- binding shikimate-3-phosphate: S24 (= S28), R28 (= R32), S168 (= S173), A169 (= A174), Q170 (= Q175), R195 (= R200), D321 (= D325), K348 (= K352)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
59% identity, 95% coverage: 17:439/443 of query aligns to 13:438/445 of 2gg6A
- active site: K23 (= K27), S24 (= S28), D50 (= D54), N93 (= N98), R123 (= R128), D321 (= D325), E349 (= E353), H399 (= H400), R400 (= R401), T426 (= T427)
- binding shikimate-3-phosphate: S24 (= S28), R28 (= R32), T96 (= T101), S168 (= S173), Q170 (= Q175), D321 (= D325), K348 (= K352)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
49% identity, 94% coverage: 17:432/443 of query aligns to 11:418/438 of Q83E11
- KS 21:22 (= KS 27:28) binding
- R26 (= R32) binding
- NSGT 93:96 (= NSGT 98:101) Phosphoenolpyruvate
- R123 (= R128) binding
- D315 (= D325) active site, Proton acceptor
- K342 (= K352) binding
- R346 (= R356) binding
- R387 (= R401) binding
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
49% identity, 94% coverage: 17:432/443 of query aligns to 13:420/440 of 3slhD
- active site: K23 (= K27), S24 (= S28), D50 (= D54), N95 (= N98), R125 (= R128), D317 (= D325), E345 (= E353), H388 (= H400), R389 (= R401), T415 (= T427)
- binding glyphosate: K23 (= K27), G97 (= G100), T98 (= T101), R125 (= R128), Q171 (= Q175), D317 (= D325), E345 (= E353), R348 (= R356), H388 (= H400), R389 (= R401)
- binding shikimate-3-phosphate: S24 (= S28), R28 (= R32), S169 (= S173), Q171 (= Q175), R196 (= R200), D317 (= D325), K344 (= K352)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S28), R28 (= R32), T98 (= T101), Q171 (= Q175), R196 (= R200), D317 (= D325), K344 (= K352)
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
49% identity, 94% coverage: 17:432/443 of query aligns to 13:416/434 of 4egrA
- active site: K23 (= K27), S24 (= S28), D50 (= D54), N95 (= N98), R125 (= R128), D313 (= D325), E341 (= E353), H384 (= H400), R385 (= R401), T411 (= T427)
- binding phosphoenolpyruvate: K23 (= K27), G97 (= G100), T98 (= T101), R125 (= R128), D313 (= D325), E341 (= E353), R344 (= R356), R385 (= R401)
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
44% identity, 95% coverage: 17:439/443 of query aligns to 10:424/427 of 1rf6A
- active site: K20 (= K27), S21 (= S28), D47 (= D54), N90 (= N98), D115 (≠ A123), R120 (= R128), D312 (= D325), E340 (= E353), H384 (= H400), R385 (= R401), T412 (= T427)
- binding glyphosate: K20 (= K27), G92 (= G100), T93 (= T101), R120 (= R128), Q168 (= Q175), D312 (= D325), E340 (= E353), R343 (= R356), H384 (= H400), R385 (= R401)
- binding shikimate-3-phosphate: S21 (= S28), R25 (= R32), S166 (= S173), Q168 (= Q175), R193 (= R200), I311 (= I324), D312 (= D325), K339 (= K352)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
44% identity, 95% coverage: 17:439/443 of query aligns to 10:424/427 of 1rf4A
- active site: K20 (= K27), S21 (= S28), D47 (= D54), N90 (= N98), D115 (≠ A123), R120 (= R128), D312 (= D325), E340 (= E353), H384 (= H400), R385 (= R401), T412 (= T427)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K27), S21 (= S28), R25 (= R32), G92 (= G100), T93 (= T101), R120 (= R128), S166 (= S173), A167 (= A174), Q168 (= Q175), R193 (= R200), D312 (= D325), K339 (= K352), E340 (= E353), R343 (= R356), H384 (= H400), R385 (= R401)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
44% identity, 95% coverage: 17:439/443 of query aligns to 10:424/427 of Q9S400
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
29% identity, 95% coverage: 17:436/443 of query aligns to 11:419/426 of 7tm6A
- binding glyphosate: K21 (= K27), G95 (= G100), R123 (= R128), Q170 (= Q175), D312 (= D325), E340 (= E353), R343 (= R356), H384 (= H400), R385 (= R401)
- binding shikimate-3-phosphate: S22 (= S28), R26 (= R32), T96 (= T101), S168 (= S173), S169 (≠ A174), Q170 (= Q175), S196 (vs. gap), Y199 (≠ V197), D312 (= D325), N335 (≠ E348), K339 (= K352)
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
29% identity, 95% coverage: 17:436/443 of query aligns to 12:420/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K27), S23 (= S28), R27 (= R32), S169 (= S173), S170 (≠ A174), Q171 (= Q175), S197 (vs. gap), Y200 (≠ V197), D313 (= D325), N336 (≠ E348), K340 (= K352)
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
31% identity, 95% coverage: 20:439/443 of query aligns to 401:827/1555 of 6hqvA
Sites not aligning to the query:
- active site: 123, 145, 187, 243, 253, 257, 261, 264, 268, 280
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding glutamic acid: 139, 145, 187, 243, 257, 264, 280
- binding nicotinamide-adenine-dinucleotide: 42, 44, 45, 76, 79, 107, 108, 109, 112, 132, 133, 135, 139, 140, 145, 154, 175, 176, 177, 180, 280
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
- binding zinc ion: 187, 264, 280
P11043 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EC 2.5.1.19 from Petunia hybrida (Petunia) (see paper)
27% identity, 96% coverage: 17:440/443 of query aligns to 85:514/516 of P11043
- G173 (= G100) mutation to A: Resistance to glyphosate due to a lower affinity. Slight reduction in EPSP synthase activity.
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
27% identity, 96% coverage: 17:440/443 of query aligns to 12:425/426 of 3nvsA
- active site: K22 (= K27), S23 (= S28), D49 (= D54), N94 (= N98), P119 (≠ A123), R124 (= R128), H128 (≠ R132), Q135 (≠ R139), Y142 (≠ S146), E144 (≠ P148), A247 (= A247), A255 (≠ S255), D314 (= D325), E342 (= E353), H386 (= H400), R387 (= R401), K412 (≠ T427)
- binding glyphosate: K22 (= K27), G96 (= G100), R124 (= R128), Q172 (= Q175), D314 (= D325), E342 (= E353), R345 (= R356), H386 (= H400), R387 (= R401)
- binding magnesium ion: E123 (≠ K127), Q145 (≠ G149)
- binding shikimate-3-phosphate: K22 (= K27), S23 (= S28), R27 (= R32), T97 (= T101), S170 (= S173), S171 (≠ A174), Q172 (= Q175), S198 (≠ T199), Y201 (vs. gap), D314 (= D325), N337 (≠ E348), K341 (= K352)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S28), R27 (= R32), Q172 (= Q175), Y201 (vs. gap), D314 (= D325), K341 (= K352)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
27% identity, 96% coverage: 17:440/443 of query aligns to 12:425/426 of Q9KRB0
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
29% identity, 94% coverage: 19:436/443 of query aligns to 14:420/427 of 2pq9A
- active site: K22 (= K27), S23 (= S28), D49 (= D54), N94 (= N98), P119 (≠ A123), R124 (= R128), D313 (≠ L310), E341 (= E353), H385 (= H400), R386 (= R401), K411 (≠ T427)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K27), S23 (= S28), R27 (= R32), G96 (= G100), T97 (= T101), R124 (= R128), S169 (= S173), S170 (≠ A174), Q171 (= Q175), S197 (≠ T199), Y200 (vs. gap), D313 (≠ L310), N336 (≠ E348), K340 (= K352), R344 (= R356), H385 (= H400), R386 (= R401), K411 (≠ T427)
2aa9A Epsp synthase liganded with shikimate (see paper)
29% identity, 94% coverage: 19:436/443 of query aligns to 14:420/427 of 2aa9A
- active site: K22 (= K27), S23 (= S28), D49 (= D54), N94 (= N98), P119 (≠ A123), R124 (= R128), D313 (≠ L310), E341 (= E353), H385 (= H400), R386 (= R401), K411 (≠ T427)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: K22 (= K27), S23 (= S28), R27 (= R32), T97 (= T101), Q171 (= Q175), Y200 (vs. gap), D313 (≠ L310), K340 (= K352)
1x8tA Epsps liganded with the (r)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
29% identity, 94% coverage: 19:436/443 of query aligns to 14:420/427 of 1x8tA
- active site: K22 (= K27), S23 (= S28), D49 (= D54), N94 (= N98), P119 (≠ A123), R124 (= R128), D313 (≠ L310), E341 (= E353), H385 (= H400), R386 (= R401), K411 (≠ T427)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K27), S23 (= S28), R27 (= R32), T97 (= T101), S169 (= S173), S170 (≠ A174), Q171 (= Q175), S197 (≠ T199), Y200 (vs. gap), D313 (≠ L310), N336 (≠ E348), K340 (= K352), R344 (= R356), H385 (= H400), R386 (= R401)
Query Sequence
>Ga0059261_0167 FitnessBrowser__Korea:Ga0059261_0167
MSSAPPLPLAISARGPLRGTLTVPGDKSISHRSLMFAGLAVGESRIEGLLEGEDVLATAA
AMRAMGAKIERDGDGVWHVWGVGVGGLLQPETALEMGNSGTSTRLLMGLVASHPITATFT
GDASLSKRPMGRVIDPLSRMGADFTSSPGGRLPLTMRGLCPAVPIEYTLPVASAQVKSAV
LLAGLNTPGITRVIEPVLTRDHSERMLAGFGANLTVEETPQGRIISIHGEAEFKPQQITV
PGDPSSAAFWMVAASIVPGSDITVANVGLNPTRIGLITALRMMGADITEVNPRIVGGEPV
ADLRVRHAPLSAIEVPHDLAPSMIDEYPVLFVAAAFAVGRTIARGAEELRVKESDRIAAM
VAALAPNGVPLEEFEDGLAITGTGGGPIAGGAPVASKLDHRIAMSMAVAGLGAKADVSID
DVSPVATSYPGFFSTLDSLTGRT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory