SitesBLAST
Comparing Ga0059261_0201 FitnessBrowser__Korea:Ga0059261_0201 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
36% identity, 89% coverage: 9:413/455 of query aligns to 16:417/425 of O59010
- S65 (≠ T71) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A278) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 278:280) binding
- M311 (≠ L313) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ S316) binding
- V355 (= V357) binding
- D394 (= D390) binding
- M395 (= M391) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R393) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N397) binding
- D405 (≠ N401) mutation to N: Strongly decreased affinity for aspartate.
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
36% identity, 89% coverage: 9:413/455 of query aligns to 8:409/409 of 6bavA
2nwwA Crystal structure of gltph in complex with tboa (see paper)
35% identity, 89% coverage: 9:412/455 of query aligns to 7:407/407 of 2nwwA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
35% identity, 89% coverage: 9:412/455 of query aligns to 8:408/408 of 6bauA
- binding cysteine: S270 (= S280), M303 (≠ L313), T306 (≠ S316), A345 (= A355), G346 (= G356), V347 (= V357), G351 (≠ S361), D386 (= D390), C389 (≠ R393), T390 (≠ S394), N393 (= N397)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
35% identity, 89% coverage: 9:413/455 of query aligns to 16:417/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ V52), F46 (≠ V52), P75 (≠ T82), L91 (≠ C98), F95 (≠ V102), L130 (= L140), I133 (≠ F143), I159 (≠ L169), Y167 (vs. gap), K196 (≠ Q198), G200 (≠ Y202), I207 (= I209), F210 (= F212), L250 (≠ V256), I262 (≠ V264), M269 (≠ L271), T334 (= T336), V335 (≠ L337), G336 (= G338), T340 (= T342), L343 (= L345), M399 (≠ A395)
- binding aspartic acid: S277 (= S279), S278 (= S280), T314 (≠ S316), G354 (= G356), A358 (= A360), G359 (≠ S361), D394 (= D390), R397 (= R393), T398 (≠ S394)
- binding sodium ion: Y89 (≠ F96), T92 (≠ A99), S93 (= S100), G306 (= G308), T308 (≠ S310), N310 (= N312), N310 (= N312), M311 (≠ L313), D312 (= D314), S349 (= S351), I350 (≠ K352), T352 (≠ I354), N401 (= N397), V402 (= V398), D405 (≠ N401)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
35% identity, 89% coverage: 9:412/455 of query aligns to 13:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G75), V83 (= V93), I157 (≠ F170), Y164 (vs. gap), K193 (≠ Q198), T305 (≠ S310), I306 (≠ F311), I347 (≠ K352)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I9), M199 (= M204), S275 (= S280), T311 (≠ S316), G356 (≠ S361), L384 (= L383), D391 (= D390), R394 (= R393)
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
34% identity, 89% coverage: 9:412/455 of query aligns to 8:396/396 of 6bmiA
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
34% identity, 89% coverage: 9:412/455 of query aligns to 12:414/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
34% identity, 89% coverage: 9:412/455 of query aligns to 11:413/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ Q198), G195 (≠ Y202), R282 (≠ E289)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A278), S272 (= S279), S273 (= S280), M307 (≠ L313), T310 (≠ S316), G353 (≠ R359), A354 (= A360), R394 (= R393), T395 (≠ S394)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
35% identity, 89% coverage: 9:412/455 of query aligns to 7:405/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A278), S265 (= S280), M299 (≠ L313), T302 (≠ S316), T340 (≠ I354), G342 (= G356), V343 (= V357), G347 (≠ S361), D383 (= D390), R386 (= R393), T387 (≠ S394), N390 (= N397)
- binding decyl-beta-d-maltopyranoside: H23 (≠ S30), V212 (≠ I227), A216 (= A231)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
34% identity, 89% coverage: 9:412/455 of query aligns to 14:416/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
34% identity, 89% coverage: 9:412/455 of query aligns to 14:416/427 of 5e9sA
- binding aspartic acid: R274 (≠ A278), S275 (= S279), S276 (= S280), T313 (≠ S316), G353 (= G356), V354 (= V357), A357 (= A360), G358 (≠ S361), D394 (= D390), R397 (= R393), T398 (≠ S394)
- binding decyl-beta-d-maltopyranoside: L194 (≠ Q198), G198 (≠ Y202), Y202 (≠ F206)
- binding sodium ion: Y87 (≠ F96), T90 (≠ A99), S91 (= S100), S276 (= S280), G305 (= G308), A306 (≠ Y309), T307 (≠ S310), N309 (= N312), N309 (= N312), M310 (≠ L313), D311 (= D314), S348 (= S351), I349 (≠ K352), G350 (= G353), T351 (≠ I354), N401 (= N397), V402 (= V398), D405 (≠ N401)
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 83% coverage: 48:425/455 of query aligns to 52:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ L85), G89 (= G86), G92 (= G89), A95 (= A92), V96 (= V93), Y99 (≠ F96), M163 (≠ L169), F167 (≠ V173), F293 (= F303), V297 (≠ L307)
- binding aspartic acid: S268 (= S279), S269 (= S280), T306 (≠ S316), G346 (= G356), I347 (≠ V357), A350 (= A360), G351 (≠ S361), D380 (= D390), R383 (= R393), T384 (≠ S394)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
30% identity, 81% coverage: 48:417/455 of query aligns to 44:393/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I76), S80 (≠ L85), G81 (= G86), G84 (= G89), Y91 (≠ F96), M156 (≠ L169), F160 (≠ V173), F286 (= F303), V290 (≠ L307)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V68), I148 (= I161), S262 (= S280), S263 (≠ E281), A292 (≠ Y309), T293 (≠ S310), M296 (≠ L313), T299 (≠ S316), G329 (= G353), A336 (= A360), G337 (≠ S361), D366 (= D390), R369 (= R393), N373 (= N397)
6x2zA Heaat3-ofs-asp (see paper)
29% identity, 82% coverage: 48:420/455 of query aligns to 36:418/419 of 6x2zA
- binding aspartic acid: S275 (≠ A278), S277 (= S280), T314 (≠ S316), G354 (= G356), V355 (= V357), D388 (= D390), R391 (= R393), T392 (≠ S394)
- binding sodium ion: Y83 (≠ F96), T86 (≠ A99), T87 (≠ S100), G306 (= G308), A307 (≠ Y309), T308 (≠ S310), I309 (≠ F311), N310 (= N312), N310 (= N312), M311 (≠ L313), M311 (≠ L313), D312 (= D314), S349 (= S351), I350 (≠ K352), G351 (= G353), A352 (≠ I354), N395 (= N397), D399 (≠ N401)
7nsgA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b
29% identity, 82% coverage: 48:420/455 of query aligns to 42:428/430 of 7nsgA
- binding (+)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: S287 (= S280), D398 (= D390), R401 (= R393), T402 (≠ S394), N405 (= N397)
- binding (-)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: P366 (= P358), D398 (= D390), R401 (= R393), T402 (≠ S394)
- binding cholesterol hemisuccinate: I258 (≠ C252), L419 (≠ W411)
6s3qA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with tfb-tboa
29% identity, 82% coverage: 48:420/455 of query aligns to 42:428/430 of 6s3qA
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: S286 (= S279), S287 (= S280), T324 (≠ S316), A358 (≠ T350), G361 (= G353), V365 (= V357), A368 (= A360), T372 (≠ V364), D398 (= D390), R401 (= R393), T402 (≠ S394), N405 (= N397)
- binding cholesterol hemisuccinate: K80 (≠ R87), R84 (= R91)
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
29% identity, 82% coverage: 48:420/455 of query aligns to 38:413/416 of 8cuaA
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
29% identity, 82% coverage: 48:420/455 of query aligns to 38:431/433 of 8cv2A
- binding sodium ion: Y85 (≠ F96), T88 (≠ A99), T89 (≠ S100), G319 (= G308), A320 (≠ Y309), N323 (= N312), N323 (= N312), M324 (≠ L313), D325 (= D314), N408 (= N397), D412 (≠ N401)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
28% identity, 80% coverage: 55:420/455 of query aligns to 49:422/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S279), S281 (= S280), T318 (≠ S316), G363 (≠ S361), M367 (≠ I365), V385 (≠ L383), D388 (= D386), R395 (= R393), T396 (≠ S394)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ H387)
- binding cholesterol hemisuccinate: R80 (= R87), R84 (= R91), I95 (≠ V102), I252 (≠ C252)
Sites not aligning to the query:
Query Sequence
>Ga0059261_0201 FitnessBrowser__Korea:Ga0059261_0201
MAKKLTTFILIALVAGAIVGLGLHYGIHNSFGADSAGAEAELKTVAGYFSIVTTIFLRLI
KMIIAPLVFATLVAGIAHMGDTAALGRVGGRAVAWFICASLVSLTLGLILVNLFQPGVGL
NFPLPPVDATSGVEKAAFNLKDFFTHVFPASGIEAMAKNEILQIVIFSLFIGVAITAVGE
KAKPLVSAVEALVHVMLQVTNYVMRFAPIAVFAAVAGTLAERGPAIIGNLAYFMGTFYIA
MFTLWALLIGVCYLIVGKRTGLLVRYIRDPLLLAFSTASSEAAYPRTLEALDRFGVPPRI
ASFVLPLGYSFNLDGSMIYMTFATIFIAQAYGIDLTLGQEITMLLVLMITSKGIAGVPRA
SLVVIAATLGFFDIPEAGLLLILGIDHFLDMGRSATNVVGNAVASAVVAKWEGGRLDPIE
PADIEPPHAPTGGGPAVDEQSFSEFGKPPAGGSQA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory