Comparing Ga0059261_0254 FitnessBrowser__Korea:Ga0059261_0254 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
43% identity, 98% coverage: 1:244/248 of query aligns to 1:249/253 of P00943
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
43% identity, 98% coverage: 2:244/248 of query aligns to 1:248/251 of 1btmA
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
41% identity, 98% coverage: 2:244/248 of query aligns to 4:250/252 of 6neeB
P27876 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Bacillus subtilis (strain 168) (see paper)
41% identity, 98% coverage: 1:243/248 of query aligns to 1:248/253 of P27876
P00942 Triosephosphate isomerase; TIM; Triose-phosphate isomerase; EC 5.3.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
40% identity, 98% coverage: 2:244/248 of query aligns to 3:246/248 of P00942
Sites not aligning to the query:
3ypiA Electrophilic catalysis in triosephosphase isomerase: the role of histidine-95 (see paper)
40% identity, 98% coverage: 2:244/248 of query aligns to 2:245/247 of 3ypiA
3uwuA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-3-phosphate (see paper)
39% identity, 99% coverage: 1:245/248 of query aligns to 1:252/253 of 3uwuA
Q6GIL6 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Staphylococcus aureus (strain MRSA252) (see paper)
39% identity, 99% coverage: 1:245/248 of query aligns to 1:252/253 of Q6GIL6
3uwzA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
39% identity, 99% coverage: 1:245/248 of query aligns to 2:253/254 of 3uwzA
3uwwA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 3-phosphoglyceric acid (see paper)
39% identity, 99% coverage: 1:245/248 of query aligns to 2:253/254 of 3uwwA
3uwvA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 2-phosphoglyceric acid (see paper)
39% identity, 99% coverage: 1:245/248 of query aligns to 3:254/255 of 3uwvA
4ff7B Structure of c126s mutant of saccharomyces cerevisiae triosephosphate isomerase (see paper)
40% identity, 98% coverage: 2:244/248 of query aligns to 2:245/247 of 4ff7B
4ff7A Structure of c126s mutant of saccharomyces cerevisiae triosephosphate isomerase (see paper)
40% identity, 98% coverage: 2:244/248 of query aligns to 2:245/247 of 4ff7A
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
40% identity, 97% coverage: 2:241/248 of query aligns to 402:645/654 of P36204
Sites not aligning to the query:
6oogA Crystal structure of triosephosphate isomerase from taenia solium in complex with 2pg (see paper)
41% identity, 98% coverage: 1:244/248 of query aligns to 3:250/252 of 6oogA
5zfxB Crystal structure of triosephosphate isomerase from opisthorchis viverrini (see paper)
40% identity, 99% coverage: 2:246/248 of query aligns to 1:248/248 of 5zfxB
4y90A Crystal structure of triosephosphate isomerase from deinococcus radiodurans (see paper)
46% identity, 98% coverage: 3:244/248 of query aligns to 2:242/244 of 4y90A
5eywA Crystal structure of litopenaeus vannamei triosephosphate isomerase complexed with 2-phosphoglycolic acid (see paper)
38% identity, 98% coverage: 2:244/248 of query aligns to 1:243/244 of 5eywA
3uwzB Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
38% identity, 99% coverage: 1:245/248 of query aligns to 1:249/250 of 3uwzB
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
42% identity, 98% coverage: 2:245/248 of query aligns to 2:249/250 of 4y96A
>Ga0059261_0254 FitnessBrowser__Korea:Ga0059261_0254
MRRKLVAGNWKMHGLIAALPEIEAIAQAAAVTPGVDAALCVPATLIAPAVTVAARMPIGG
QDCHAADQGAHTGCISAAMLREAGAALTIVGHSERRANQGETDADVKGKAEAAHRHGLNA
ILCVGETLEQRDAGQAEAVVTAQLAGSMPEGAAADWLSIAYEPVWAIGTGRTPTEADVAA
MHGAIRAKLTELLGGETAAAMRVLYGGSVNGANAASLLGCADVDGALVGGASLTAEKFVP
IIEAAAGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory