SitesBLAST
Comparing Ga0059261_0285 FitnessBrowser__Korea:Ga0059261_0285 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
28% identity, 96% coverage: 7:537/552 of query aligns to 12:558/599 of 1n0hA
- active site: Y31 (≠ V26), G33 (= G28), G34 (≠ E29), A35 (≠ S30), I36 (≠ F31), E57 (= E52), T80 (= T75), F119 (= F114), Q120 (= Q115), E121 (= E116), K169 (≠ E164), R230 (= R221), M266 (≠ Y257), V293 (≠ T284), V409 (≠ A389), L434 (vs. gap), G435 (= G414), M437 (= M416), D462 (= D441), N489 (= N468), E491 (≠ A470), Q492 (≠ Y471), M494 (≠ T473), V495 (≠ I474), W498 (≠ H477), L520 (= L499), G525 (= G504), L526 (≠ C505)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (≠ A389), G410 (= G390), Q411 (≠ N391), H412 (≠ F392), G435 (= G414), M437 (= M416), G461 (= G440), D462 (= D441), A463 (≠ G442), S464 (≠ D443), M467 (= M446), N489 (= N468), E491 (≠ A470), Q492 (≠ Y471), G493 (= G472), V495 (≠ I474)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (≠ E29), A35 (≠ S30), V109 (= V104), P110 (≠ D105), F119 (= F114), K169 (≠ E164), M266 (≠ Y257), D291 (≠ E282), R292 (≠ A283), V495 (≠ I474), W498 (≠ H477)
- binding flavin-adenine dinucleotide: R159 (= R154), G219 (= G211), A220 (≠ G212), G221 (≠ A213), N224 (≠ D216), T246 (≠ A237), L247 (≠ F238), Q248 (≠ R239), L264 (= L255), G265 (= G256), M266 (≠ Y257), H267 (≠ G258), G286 (= G277), A287 (= A278), R288 (= R279), D290 (≠ G281), R292 (≠ A283), V293 (≠ T284), E319 (≠ H304), V320 (≠ P305), N324 (≠ E309), G337 (≠ C322), D338 (= D323), A339 (≠ V324), M414 (≠ G394), G432 (≠ T412), G433 (≠ S413)
- binding magnesium ion: D462 (= D441), N489 (= N468), E491 (≠ A470)
- binding thiamine diphosphate: Y31 (≠ V26), E57 (= E52), P83 (= P78)
Sites not aligning to the query:
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
28% identity, 96% coverage: 7:537/552 of query aligns to 10:554/595 of 1t9bB
- active site: Y29 (≠ V26), G31 (= G28), G32 (≠ E29), A33 (≠ S30), I34 (≠ F31), E55 (= E52), T78 (= T75), F117 (= F114), Q118 (= Q115), E119 (= E116), K167 (≠ E164), R226 (= R221), M262 (≠ Y257), V289 (≠ T284), V405 (≠ A389), L430 (vs. gap), G431 (= G414), M433 (= M416), D458 (= D441), N485 (= N468), E487 (≠ A470), Q488 (≠ Y471), M490 (≠ T473), V491 (≠ I474), W494 (≠ H477), L516 (= L499), G521 (= G504), L522 (≠ C505)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V104), P108 (≠ D105), D287 (≠ E282), R288 (≠ A283), M490 (≠ T473), W494 (≠ H477)
- binding flavin-adenine dinucleotide: R157 (= R154), G215 (= G211), A216 (≠ G212), G217 (≠ A213), N220 (≠ D216), T242 (≠ A237), L243 (≠ F238), Q244 (≠ R239), M259 (≠ N254), L260 (= L255), M262 (≠ Y257), H263 (≠ G258), G282 (= G277), A283 (= A278), R284 (= R279), D286 (≠ G281), R288 (≠ A283), V289 (≠ T284), E315 (≠ H304), V316 (≠ P305), N320 (≠ E309), G333 (≠ C322), D334 (= D323), A335 (≠ V324), Q409 (≠ S393), M410 (≠ G394), G428 (≠ T412), G429 (≠ S413)
- binding magnesium ion: D458 (= D441), N485 (= N468), E487 (≠ A470)
Sites not aligning to the query:
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
28% identity, 96% coverage: 7:537/552 of query aligns to 10:550/591 of 5wkcA
- active site: Y29 (≠ V26), G31 (= G28), G32 (≠ E29), A33 (≠ S30), I34 (≠ F31), E55 (= E52), T78 (= T75), F117 (= F114), Q118 (= Q115), E119 (= E116), K167 (≠ E164), R222 (= R221), M258 (≠ Y257), V285 (≠ T284), V401 (≠ A389), L426 (vs. gap), G427 (= G414), M429 (= M416), D454 (= D441), N481 (= N468), E483 (≠ A470), Q484 (≠ Y471), M486 (≠ T473), V487 (≠ I474), W490 (≠ H477), L512 (= L499), G517 (= G504), L518 (≠ C505)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (≠ A389), G402 (= G390), Q403 (≠ N391), H404 (≠ F392), G427 (= G414), M429 (= M416), G453 (= G440), D454 (= D441), A455 (≠ G442), S456 (≠ D443), M459 (= M446), N481 (= N468), E483 (≠ A470), Q484 (≠ Y471), G485 (= G472), M486 (≠ T473), V487 (≠ I474)
- binding ethaneperoxoic acid: G32 (≠ E29), Q118 (= Q115)
- binding flavin-adenine dinucleotide: R157 (= R154), G211 (= G211), A212 (≠ G212), G213 (≠ A213), N216 (≠ D216), T238 (≠ A237), L239 (≠ F238), Q240 (≠ R239), L256 (= L255), M258 (≠ Y257), G278 (= G277), A279 (= A278), R280 (= R279), R284 (≠ A283), V285 (≠ T284), E311 (≠ H304), V312 (≠ P305), N316 (≠ E309), D330 (= D323), A331 (≠ V324), M406 (≠ G394), G424 (≠ T412)
- binding magnesium ion: D454 (= D441), N481 (= N468), E483 (≠ A470)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (≠ E29), A33 (≠ S30), V107 (= V104), F117 (= F114), K167 (≠ E164), M258 (≠ Y257), R284 (≠ A283), M486 (≠ T473), W490 (≠ H477)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (= P27), E55 (= E52)
Sites not aligning to the query:
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
29% identity, 96% coverage: 7:537/552 of query aligns to 10:542/583 of 1t9bA
- active site: Y29 (≠ V26), G31 (= G28), G32 (≠ E29), A33 (≠ S30), I34 (≠ F31), E55 (= E52), T78 (= T75), F117 (= F114), Q118 (= Q115), E119 (= E116), K167 (≠ E164), R214 (= R221), M250 (≠ Y257), V277 (≠ T284), V393 (≠ A389), L418 (vs. gap), G419 (= G414), M421 (= M416), D446 (= D441), N473 (= N468), E475 (≠ A470), Q476 (≠ Y471), M478 (≠ T473), V479 (≠ I474), W482 (≠ H477), L504 (= L499), G509 (= G504), L510 (≠ C505)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V104), P108 (≠ D105), F117 (= F114), D275 (≠ E282), R276 (≠ A283), M478 (≠ T473), W482 (≠ H477)
- binding flavin-adenine dinucleotide: R157 (= R154), G203 (= G211), A204 (≠ G212), G205 (≠ A213), N208 (≠ D216), T230 (≠ A237), L231 (≠ F238), Q232 (≠ R239), M247 (≠ N254), L248 (= L255), M250 (≠ Y257), H251 (≠ G258), G270 (= G277), A271 (= A278), R272 (= R279), D274 (≠ G281), R276 (≠ A283), V277 (≠ T284), E303 (≠ H304), V304 (≠ P305), N308 (≠ E309), D322 (= D323), A323 (≠ V324), Q397 (≠ S393), M398 (≠ G394), G416 (≠ T412), G417 (≠ S413)
- binding magnesium ion: D446 (= D441), N473 (= N468), E475 (≠ A470)
Sites not aligning to the query:
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
29% identity, 96% coverage: 7:537/552 of query aligns to 9:541/582 of 1t9dB
- active site: Y28 (≠ V26), G30 (= G28), G31 (≠ E29), A32 (≠ S30), I33 (≠ F31), E54 (= E52), T77 (= T75), F116 (= F114), Q117 (= Q115), E118 (= E116), K166 (≠ E164), R213 (= R221), M249 (≠ Y257), V276 (≠ T284), V392 (≠ A389), L417 (vs. gap), G418 (= G414), M420 (= M416), D445 (= D441), N472 (= N468), E474 (≠ A470), Q475 (≠ Y471), M477 (≠ T473), V478 (≠ I474), W481 (≠ H477), L503 (= L499), G508 (= G504), L509 (≠ C505)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (≠ E29), A32 (≠ S30), V106 (= V104), P107 (≠ D105), F116 (= F114), K166 (≠ E164), M249 (≠ Y257), D274 (≠ E282), R275 (≠ A283), W481 (≠ H477)
- binding flavin-adenine dinucleotide: R156 (= R154), G202 (= G211), A203 (≠ G212), G204 (≠ A213), N207 (≠ D216), T229 (≠ A237), L230 (≠ F238), Q231 (≠ R239), L247 (= L255), M249 (≠ Y257), H250 (≠ G258), G269 (= G277), A270 (= A278), R271 (= R279), D273 (≠ G281), R275 (≠ A283), V276 (≠ T284), E302 (≠ H304), V303 (≠ P305), N307 (≠ E309), G320 (≠ C322), D321 (= D323), A322 (≠ V324), Q396 (≠ S393), M397 (≠ G394), G415 (≠ T412), G416 (≠ S413)
- binding magnesium ion: D445 (= D441), N472 (= N468), E474 (≠ A470)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E52), P80 (= P78), G418 (= G414), M420 (= M416), M450 (= M446)
Sites not aligning to the query:
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
28% identity, 96% coverage: 7:537/552 of query aligns to 11:556/597 of 1t9aA
- active site: Y30 (≠ V26), G32 (= G28), G33 (≠ E29), A34 (≠ S30), I35 (≠ F31), E56 (= E52), T79 (= T75), F118 (= F114), Q119 (= Q115), E120 (= E116), K168 (≠ E164), R228 (= R221), M264 (≠ Y257), V291 (≠ T284), V407 (≠ A389), L432 (vs. gap), G433 (= G414), M435 (= M416), D460 (= D441), N487 (= N468), E489 (≠ A470), Q490 (≠ Y471), M492 (≠ T473), V493 (≠ I474), W496 (≠ H477), L518 (= L499), G523 (= G504), L524 (≠ C505)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (≠ E29), V108 (= V104), P109 (≠ D105), F118 (= F114), K168 (≠ E164), M264 (≠ Y257), D289 (≠ E282), R290 (≠ A283), M492 (≠ T473), V493 (≠ I474), W496 (≠ H477)
- binding flavin-adenine dinucleotide: R158 (= R154), G217 (= G211), A218 (≠ G212), G219 (≠ A213), N222 (≠ D216), T244 (≠ A237), L245 (≠ F238), Q246 (≠ R239), L262 (= L255), M264 (≠ Y257), H265 (≠ G258), G284 (= G277), A285 (= A278), R286 (= R279), D288 (≠ G281), R290 (≠ A283), V291 (≠ T284), E317 (≠ H304), V318 (≠ P305), N322 (≠ E309), G335 (≠ C322), D336 (= D323), A337 (≠ V324), Q411 (≠ S393), M412 (≠ G394), G430 (≠ T412), G431 (≠ S413)
- binding magnesium ion: D460 (= D441), N487 (= N468), E489 (≠ A470)
- binding propyl trihydrogen diphosphate: V407 (≠ A389), G408 (= G390), Q409 (≠ N391), H410 (≠ F392), M435 (= M416), G459 (= G440), D460 (= D441), A461 (≠ G442), S462 (≠ D443), N487 (= N468), E489 (≠ A470), Q490 (≠ Y471), G491 (= G472), M492 (≠ T473)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G414), M435 (= M416), M465 (= M446)
Sites not aligning to the query:
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
28% identity, 96% coverage: 7:537/552 of query aligns to 10:555/596 of 1t9dA
- active site: Y29 (≠ V26), G31 (= G28), G32 (≠ E29), A33 (≠ S30), I34 (≠ F31), E55 (= E52), T78 (= T75), F117 (= F114), Q118 (= Q115), E119 (= E116), K167 (≠ E164), R227 (= R221), M263 (≠ Y257), V290 (≠ T284), V406 (≠ A389), L431 (vs. gap), G432 (= G414), M434 (= M416), D459 (= D441), N486 (= N468), E488 (≠ A470), Q489 (≠ Y471), M491 (≠ T473), V492 (≠ I474), W495 (≠ H477), L517 (= L499), G522 (= G504), L523 (≠ C505)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ E29), A33 (≠ S30), V107 (= V104), P108 (≠ D105), F117 (= F114), K167 (≠ E164), M263 (≠ Y257), D288 (≠ E282), R289 (≠ A283), W495 (≠ H477)
- binding flavin-adenine dinucleotide: R157 (= R154), G216 (= G211), A217 (≠ G212), G218 (≠ A213), N221 (≠ D216), T243 (≠ A237), L244 (≠ F238), Q245 (≠ R239), M260 (≠ N254), L261 (= L255), H264 (≠ G258), G283 (= G277), A284 (= A278), R285 (= R279), D287 (≠ G281), R289 (≠ A283), V290 (≠ T284), E316 (≠ H304), V317 (≠ P305), N321 (≠ E309), G334 (≠ C322), D335 (= D323), A336 (≠ V324), Q410 (≠ S393), M411 (≠ G394), G429 (≠ T412), G430 (≠ S413)
- binding magnesium ion: D459 (= D441), N486 (= N468), E488 (≠ A470)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E52), P81 (= P78), Q118 (= Q115), G432 (= G414), M434 (= M416), M464 (= M446)
Sites not aligning to the query:
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
28% identity, 96% coverage: 7:537/552 of query aligns to 10:555/596 of 1t9cA
- active site: Y29 (≠ V26), G31 (= G28), G32 (≠ E29), A33 (≠ S30), I34 (≠ F31), E55 (= E52), T78 (= T75), F117 (= F114), Q118 (= Q115), E119 (= E116), K167 (≠ E164), R227 (= R221), M263 (≠ Y257), V290 (≠ T284), V406 (≠ A389), L431 (vs. gap), G432 (= G414), M434 (= M416), D459 (= D441), N486 (= N468), E488 (≠ A470), Q489 (≠ Y471), M491 (≠ T473), V492 (≠ I474), W495 (≠ H477), L517 (= L499), G522 (= G504), L523 (≠ C505)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ E29), V107 (= V104), P108 (≠ D105), F117 (= F114), K167 (≠ E164), D288 (≠ E282), R289 (≠ A283), W495 (≠ H477)
- binding flavin-adenine dinucleotide: R157 (= R154), G216 (= G211), A217 (≠ G212), G218 (≠ A213), N221 (≠ D216), T243 (≠ A237), L244 (≠ F238), Q245 (≠ R239), L261 (= L255), M263 (≠ Y257), H264 (≠ G258), G283 (= G277), A284 (= A278), R285 (= R279), D287 (≠ G281), R289 (≠ A283), V290 (≠ T284), E316 (≠ H304), V317 (≠ P305), N321 (≠ E309), G334 (≠ C322), D335 (= D323), A336 (≠ V324), M411 (≠ G394), G429 (≠ T412), G430 (≠ S413)
- binding magnesium ion: D459 (= D441), N486 (= N468), E488 (≠ A470)
Sites not aligning to the query:
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
28% identity, 96% coverage: 7:537/552 of query aligns to 14:566/607 of 6u9dB
- active site: Y33 (≠ V26), G35 (= G28), G36 (≠ E29), A37 (≠ S30), I38 (≠ F31), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (≠ E164), M274 (≠ Y257), V301 (≠ T284), V417 (≠ A389), G443 (= G414), M445 (= M416), D470 (= D441), N497 (= N468), E499 (≠ A470), Q500 (≠ Y471), M502 (≠ T473), V503 (≠ I474), W506 (≠ H477)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (≠ E29), V111 (= V104), P112 (≠ D105), F121 (= F114), K171 (≠ E164), D299 (≠ E282), R300 (≠ A283), M502 (≠ T473), W506 (≠ H477)
- binding flavin-adenine dinucleotide: R161 (= R154), A228 (≠ G212), G229 (≠ A213), N232 (≠ D216), T254 (≠ A237), L255 (≠ F238), Q256 (≠ R239), L272 (= L255), M274 (≠ Y257), G294 (= G277), R296 (= R279), D298 (≠ G281), R300 (≠ A283), V301 (≠ T284), E327 (≠ H304), V328 (≠ P305), N332 (≠ E309), D346 (= D323), A347 (≠ V324), M422 (≠ G394), G440 (≠ T412), G441 (≠ S413)
- binding magnesium ion: D470 (= D441), N497 (= N468)
- binding thiamine diphosphate: E59 (= E52), P85 (= P78), V417 (≠ A389), G418 (= G390), Q419 (≠ N391), H420 (≠ F392), G443 (= G414), M445 (= M416), A471 (≠ G442), S472 (≠ D443), N497 (= N468), E499 (≠ A470), Q500 (≠ Y471), G501 (= G472), M502 (≠ T473), V503 (≠ I474)
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 96% coverage: 7:537/552 of query aligns to 94:646/687 of P07342
- R241 (= R154) binding
- 355:376 (vs. 258:279, 32% identical) binding
- 407:426 (vs. 304:323, 30% identical) binding
6lpiB Crystal structure of ahas holo-enzyme (see paper)
29% identity, 97% coverage: 6:539/552 of query aligns to 7:522/539 of 6lpiB
- active site: I27 (≠ V26), G29 (= G28), G30 (≠ E29), S31 (= S30), I32 (≠ F31), E53 (= E52), C76 (≠ T75), F115 (= F114), Q116 (= Q115), E117 (= E116), K165 (≠ E164), M256 (≠ Y257), A283 (≠ T284), V375 (≠ A389), G401 (= G414), M403 (= M416), D428 (= D441), N455 (= N468), A457 (= A470), L458 (≠ Y471), L460 (≠ T473), V461 (≠ I474), Q464 (≠ H477)
- binding flavin-adenine dinucleotide: R155 (= R154), G212 (= G211), G213 (= G212), G214 (≠ A213), T236 (≠ A237), L237 (≠ F238), M238 (≠ R239), L254 (= L255), M256 (≠ Y257), H257 (≠ G258), G276 (= G277), A277 (= A278), R278 (= R279), D280 (≠ G281), R282 (≠ A283), A283 (≠ T284), D300 (≠ H304), I301 (≠ P305), D319 (= D323), V320 (= V324), M380 (≠ G394), G398 (≠ S413)
- binding magnesium ion: D428 (= D441), N455 (= N468)
- binding thiamine diphosphate: E53 (= E52), C76 (≠ T75), P79 (= P78), G376 (= G390), Q377 (≠ N391), H378 (≠ F392), G401 (= G414), M403 (= M416), G427 (= G440), D428 (= D441), G429 (= G442), S430 (≠ D443), M433 (= M446), N455 (= N468), A457 (= A470), L458 (≠ Y471), G459 (= G472), L460 (≠ T473), V461 (≠ I474)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
29% identity, 96% coverage: 5:532/552 of query aligns to 94:634/667 of P09342
- C161 (= C72) modified: Disulfide link with 307
- P194 (≠ D105) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ G214) modified: Disulfide link with 161
7egvA Acetolactate synthase from trichoderma harzianum with inhibitor harzianic acid (see paper)
28% identity, 97% coverage: 5:537/552 of query aligns to 7:549/590 of 7egvA
- active site: Y28 (≠ V26), G30 (= G28), G31 (≠ E29), A32 (≠ S30), I33 (≠ F31), E54 (= E52), T77 (= T75), F116 (= F114), Q117 (= Q115), K166 (≠ E164), E220 (≠ R221), M256 (≠ Y257), V283 (≠ T284), V400 (≠ A389), L425 (vs. gap), G426 (= G414), M428 (= M416), Q483 (≠ Y471), M485 (≠ T473), V486 (≠ I474), W489 (≠ H477), L511 (= L499), G516 (= G504), I517 (≠ C505)
- binding flavin-adenine dinucleotide: R156 (= R154), G209 (= G212), Q210 (≠ A213), G211 (= G214), T236 (≠ A237), L237 (≠ F238), H238 (≠ R239), G276 (= G277), S277 (≠ A278), R278 (= R279), D280 (≠ G281), R282 (≠ A283), V283 (≠ T284), E309 (≠ H304), I310 (≠ P305), D328 (= D323), V329 (= V324), M405 (≠ G394), G423 (≠ S413), G424 (vs. gap)
- binding (2S)-3-methyl-2-[[(2S,4R)-1-methyl-4-[(2E,4E)-octa-2,4-dienoyl]-3,5-bis(oxidanylidene)pyrrolidin-2-yl]methyl]-2-oxidanyl-butanoic acid: F493 (≠ E481), Y494 (≠ F482)
- binding magnesium ion: D453 (= D441), N480 (= N468), E482 (≠ A470)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: P29 (= P27), E54 (= E52), Q117 (= Q115), V400 (≠ A389), G401 (= G390), Q402 (≠ N391), H403 (≠ F392), G426 (= G414), M428 (= M416), D453 (= D441), A454 (≠ G442), S455 (≠ D443), E482 (≠ A470), Q483 (≠ Y471), G484 (= G472), M485 (≠ T473), V486 (≠ I474)
6bd9A Saccharomyces cerevisiae acetohydroxyacid synthase
27% identity, 96% coverage: 7:537/552 of query aligns to 12:540/542 of 6bd9A
- active site: Y31 (≠ V26), G33 (= G28), G34 (≠ E29), A35 (≠ S30), I36 (≠ F31), E57 (= E52), T80 (= T75), F119 (= F114), Q120 (= Q115), E121 (= E116), K169 (≠ E164), R228 (= R221), M264 (≠ Y257), V291 (≠ T284), V407 (≠ A389), L432 (vs. gap), G433 (= G414), M435 (= M416), D460 (= D441), N487 (= N468), E489 (≠ A470), L502 (= L499), G507 (= G504), L508 (≠ C505)
- binding flavin-adenine dinucleotide: R159 (= R154), G217 (= G211), A218 (≠ G212), G219 (≠ A213), N222 (≠ D216), T244 (≠ A237), L245 (≠ F238), L262 (= L255), G263 (= G256), H265 (≠ G258), G284 (= G277), A285 (= A278), R286 (= R279), D288 (≠ G281), R290 (≠ A283), V291 (≠ T284), E317 (≠ H304), V318 (≠ P305), N322 (≠ E309), G335 (≠ C322), D336 (= D323), A337 (≠ V324)
- binding magnesium ion: D460 (= D441), N487 (= N468)
- binding oxygen molecule: G34 (≠ E29), T80 (= T75), Q120 (= Q115), A461 (≠ G442), Q494 (≠ R475)
- binding pyruvic acid: G33 (= G28), G34 (≠ E29), G34 (≠ E29), A35 (≠ S30), Q120 (= Q115)
- binding thiamine diphosphate: P32 (= P27), E57 (= E52), V407 (≠ A389), G408 (= G390), Q409 (≠ N391), H410 (≠ F392), G433 (= G414), M435 (= M416), G459 (= G440), D460 (= D441), A461 (≠ G442), S462 (≠ D443), M465 (= M446), N487 (= N468)
Sites not aligning to the query:
6wo1A Hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit (see paper)
27% identity, 96% coverage: 6:535/552 of query aligns to 10:523/551 of 6wo1A
- active site: Y30 (≠ V26), G32 (= G28), G33 (≠ E29), A34 (≠ S30), I35 (≠ F31), E56 (= E52), T79 (= T75), F118 (= F114), Q119 (= Q115), E120 (= E116), K168 (≠ E164), M255 (≠ N246), V282 (vs. gap), V398 (≠ A389), G424 (= G414), M426 (= M416), D451 (= D441), N478 (= N468)
- binding 2-methylpyrimidin-4-amine: G424 (= G414), T425 (≠ A415), M426 (= M416)
- binding diphosphate: V398 (≠ A389), G399 (= G390), Q400 (≠ N391), H401 (≠ F392), G450 (= G440), D451 (= D441), A452 (≠ G442), S453 (≠ D443)
- binding flavin-adenine dinucleotide: D97 (= D93), R158 (= R154), G208 (= G211), G210 (≠ A213), S213 (≠ D216), T235 (vs. gap), L236 (vs. gap), Q237 (vs. gap), I253 (= I244), G254 (≠ A245), M255 (≠ N246), G275 (= G277), V276 (≠ A278), R277 (= R279), D279 (vs. gap), R281 (vs. gap), V282 (vs. gap), E308 (≠ H304), I309 (≠ P305), D327 (= D323), V328 (vs. gap), Q402 (≠ S393), G421 (≠ S413), G422 (vs. gap)
- binding magnesium ion: D451 (= D441), N478 (= N468)
6bd3A Saccharomyces cerevisiae acetohydroxyacid synthase
28% identity, 96% coverage: 7:537/552 of query aligns to 12:536/538 of 6bd3A
- active site: Y31 (≠ V26), G33 (= G28), G34 (≠ E29), A35 (≠ S30), I36 (≠ F31), E57 (= E52), T80 (= T75), F119 (= F114), Q120 (= Q115), E121 (= E116), K169 (≠ E164), R225 (= R221), M261 (≠ Y257), V288 (≠ T284), V404 (≠ A389), L429 (vs. gap), G430 (= G414), M432 (= M416), D457 (= D441), N484 (= N468), L498 (= L499), G503 (= G504), L504 (≠ C505)
- binding flavin-adenine dinucleotide: R159 (= R154), G214 (= G211), A215 (≠ G212), G216 (≠ A213), N219 (≠ D216), T241 (≠ A237), L242 (≠ F238), Q243 (≠ R239), L259 (= L255), G260 (= G256), H262 (≠ G258), G281 (= G277), A282 (= A278), R283 (= R279), D285 (≠ G281), R287 (≠ A283), V288 (≠ T284), E314 (≠ H304), V315 (≠ P305), D333 (= D323), A334 (≠ V324)
- binding 2-acetyl-thiamine diphosphate: P32 (= P27), E57 (= E52), P83 (= P78)
- binding magnesium ion: D457 (= D441), N484 (= N468)
- binding oxygen molecule: A35 (≠ S30), T80 (= T75), S81 (≠ R76), Q120 (= Q115)
- binding thiamine diphosphate: V404 (≠ A389), G405 (= G390), Q406 (≠ N391), H407 (≠ F392), G430 (= G414), M432 (= M416), D457 (= D441), A458 (≠ G442), S459 (≠ D443), M462 (= M446), N484 (= N468)
Sites not aligning to the query:
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
29% identity, 96% coverage: 5:532/552 of query aligns to 91:631/664 of P09114
- P191 (≠ D105) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ H477) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
1jscA Crystal structure of the catalytic subunit of yeast acetohydroxyacid synthase: a target for herbicidal inhibitors (see paper)
27% identity, 96% coverage: 7:537/552 of query aligns to 12:539/541 of 1jscA
- active site: Y31 (≠ V26), G33 (= G28), G34 (≠ E29), A35 (≠ S30), I36 (≠ F31), E57 (= E52), T80 (= T75), F119 (= F114), Q120 (= Q115), E121 (= E116), K169 (≠ E164), M263 (≠ Y257), V290 (≠ T284), V406 (≠ A389), G432 (= G414), M434 (= M416), D459 (= D441), N486 (= N468), E488 (≠ A470)
- binding dihydrogenphosphate ion: G33 (= G28), G34 (≠ E29), Q120 (= Q115)
- binding flavin-adenine dinucleotide: R159 (= R154), G216 (= G211), A217 (≠ G212), G218 (≠ A213), N221 (≠ D216), T243 (≠ A237), L244 (≠ F238), L261 (= L255), G262 (= G256), H264 (≠ G258), G283 (= G277), A284 (= A278), R285 (= R279), D287 (≠ G281), R289 (≠ A283), V290 (≠ T284), E316 (≠ H304), V317 (≠ P305), N321 (≠ E309), G334 (≠ C322), D335 (= D323), A336 (≠ V324)
- binding magnesium ion: D459 (= D441), N486 (= N468)
- binding thiamine diphosphate: Y31 (≠ V26), P32 (= P27), E57 (= E52), P83 (= P78), V406 (≠ A389), G407 (= G390), Q408 (≠ N391), H409 (≠ F392), M434 (= M416), D459 (= D441), A460 (≠ G442), S461 (≠ D443), N486 (= N468)
Sites not aligning to the query:
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
25% identity, 96% coverage: 7:534/552 of query aligns to 16:555/599 of 6denA
- active site: Y35 (≠ V26), G37 (= G28), G38 (≠ E29), A39 (≠ S30), I40 (≠ F31), E61 (= E52), T84 (= T75), F123 (= F114), Q124 (= Q115), E125 (= E116), K173 (≠ E164), K230 (≠ R221), M266 (≠ Y257), V293 (≠ T284), V409 (≠ A389), L434 (vs. gap), G435 (= G414), M437 (= M416), D462 (= D441), N489 (= N468), E491 (≠ A470), Q492 (≠ Y471), M494 (≠ T473), V495 (≠ I474), W498 (≠ H477), L520 (= L499), N525 (≠ G504), V526 (≠ C505)
- binding flavin-adenine dinucleotide: R163 (= R154), G219 (= G211), A220 (≠ G212), G221 (≠ A213), N224 (≠ D216), T246 (≠ A237), L247 (≠ F238), Q248 (≠ R239), L264 (= L255), G286 (= G277), A287 (= A278), R288 (= R279), D290 (≠ G281), R292 (≠ A283), V293 (≠ T284), E319 (≠ H304), I320 (≠ P305), N324 (≠ E309), D338 (= D323), V339 (= V324), M414 (≠ G394), G432 (≠ S413)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (≠ Y257), D291 (≠ E282), R292 (≠ A283), W498 (≠ H477)
- binding magnesium ion: D462 (= D441), N489 (= N468), E491 (≠ A470)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (≠ A389), G410 (= G390), Q411 (≠ N391), H412 (≠ F392), G435 (= G414), M437 (= M416), G461 (= G440), D462 (= D441), A463 (≠ G442), S464 (≠ D443), N489 (= N468), E491 (≠ A470), Q492 (≠ Y471), G493 (= G472), M494 (≠ T473), V495 (≠ I474)
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
25% identity, 96% coverage: 7:534/552 of query aligns to 14:553/597 of 6demA
- active site: Y33 (≠ V26), G35 (= G28), G36 (≠ E29), A37 (≠ S30), I38 (≠ F31), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (≠ E164), K228 (≠ R221), M264 (≠ Y257), V291 (≠ T284), V407 (≠ A389), L432 (vs. gap), G433 (= G414), M435 (= M416), D460 (= D441), N487 (= N468), E489 (≠ A470), Q490 (≠ Y471), M492 (≠ T473), V493 (≠ I474), W496 (≠ H477), L518 (= L499), N523 (≠ G504), V524 (≠ C505)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (≠ Y257), D289 (≠ E282), R290 (≠ A283), M492 (≠ T473), W496 (≠ H477)
- binding flavin-adenine dinucleotide: R161 (= R154), G217 (= G211), A218 (≠ G212), G219 (≠ A213), N222 (≠ D216), T244 (≠ A237), L245 (≠ F238), Q246 (≠ R239), L262 (= L255), G284 (= G277), A285 (= A278), R286 (= R279), D288 (≠ G281), R290 (≠ A283), V291 (≠ T284), E317 (≠ H304), I318 (≠ P305), N322 (≠ E309), D336 (= D323), V337 (= V324), M412 (≠ G394), G430 (≠ S413)
- binding magnesium ion: D460 (= D441), N487 (= N468), E489 (≠ A470)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (≠ A389), G408 (= G390), Q409 (≠ N391), H410 (≠ F392), M435 (= M416), G459 (= G440), D460 (= D441), A461 (≠ G442), S462 (≠ D443), M465 (= M446), N487 (= N468), E489 (≠ A470), Q490 (≠ Y471), G491 (= G472), M492 (≠ T473), V493 (≠ I474)
Sites not aligning to the query:
Query Sequence
>Ga0059261_0285 FitnessBrowser__Korea:Ga0059261_0285
MTTLRNGGRILVDNLVAQGCDRIFHVPGESFLAVLDALHDVPEIDLVTCRQEGGAAFMAC
ADGTMTGKPGVCFVTRGPGATNASIGVHVAMQDSQPMLLFIGDVDRSMRDREGFQEVDFP
AMFAPLAKWATRIEDARRIPEYVARAWNVATSGRPGPVVIALPEDMLLDEVEAVDRPVST
PYPLMPDVNEDAAHQIVERIRAAKRPMAIVGGAGWDISTGRDFATFAERWGIPVAGAFRR
QDAIANTSSAWAGNLGYGPNPKLVQRIRDADLLLVVGARLGEATTDGYTLVTPDHPGQTL
IHVHPDPEELNRVYHADMAVCCDVGIFADMLSSLKPLDTPFSGAAEAHAEWLDWSTPKPR
EGVTLDLGQCVAAMRERLGPDDAIICNGAGNFSGWWHRYWHYGAQPTQLAPTSGAMGYGT
PAAVAAALRLRDRLAVALAGDGDFMMNGQELATAIQHDADLLVLIIDNGAYGTIRMHQER
EFPARLSGTTLHNPDFAALARAYGCWAETVVKTDEFAPALDRALAQTGVRLLHLKTDVEF
ITPGTTITAIRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory