SitesBLAST
Comparing Ga0059261_0324 FitnessBrowser__Korea:Ga0059261_0324 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
6n2oD 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
48% identity, 58% coverage: 12:210/343 of query aligns to 13:212/291 of 6n2oD
- binding magnesium ion: D101 (= D100), N129 (= N128), I131 (= I130)
- binding succinyl-coenzyme a: I57 (= I56), R62 (= R61), L134 (= L133), K136 (= K135)
- binding iron/sulfur cluster: W24 (= W23), C25 (= C24), C28 (= C27), C59 (= C58), C208 (= C206), T210 (≠ V208), F211 (≠ Y209)
- binding thiamine diphosphate: I57 (= I56), G58 (= G57), C59 (= C58), S60 (= S59), H76 (= H75), G102 (= G101), D103 (= D102), N129 (= N128), I131 (= I130), G133 (= G132), L134 (= L133), T135 (= T134)
6n2oB 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
48% identity, 58% coverage: 12:210/343 of query aligns to 13:212/291 of 6n2oB
- binding 2-oxoglutaric acid: R62 (= R61), L134 (= L133)
- binding coenzyme a: K136 (= K135), Y150 (≠ P149)
- binding magnesium ion: D101 (= D100), N129 (= N128), I131 (= I130)
- binding iron/sulfur cluster: W24 (= W23), C25 (= C24), C28 (= C27), C59 (= C58), C208 (= C206), T210 (≠ V208), F211 (≠ Y209)
- binding thiamine diphosphate: I57 (= I56), G58 (= G57), C59 (= C58), S60 (= S59), H76 (= H75), G102 (= G101), D103 (= D102), N129 (= N128), I131 (= I130), Y132 (= Y131), G133 (= G132), L134 (= L133), T135 (= T134)
6n2nB Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
48% identity, 58% coverage: 12:210/343 of query aligns to 13:212/291 of 6n2nB
- binding magnesium ion: D101 (= D100), N129 (= N128), I131 (= I130)
- binding iron/sulfur cluster: W24 (= W23), C25 (= C24), C28 (= C27), H30 (≠ D29), C59 (= C58), C208 (= C206), T210 (≠ V208), F211 (≠ Y209)
- binding thiamine diphosphate: I57 (= I56), G58 (= G57), C59 (= C58), S60 (= S59), H76 (= H75), G100 (= G99), D101 (= D100), G102 (= G101), D103 (= D102), N129 (= N128), I131 (= I130), Y132 (= Y131), G133 (= G132), L134 (= L133), T135 (= T134)
Q96XT4 2-oxoacid:ferredoxin oxidoreductase 2, subunit beta; OFOR2; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
48% identity, 56% coverage: 21:211/343 of query aligns to 9:202/304 of Q96XT4
5b46B 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form (see paper)
48% identity, 56% coverage: 21:211/343 of query aligns to 6:199/301 of 5b46B
- binding magnesium ion: D87 (= D100), N115 (= N128), V117 (≠ I130)
- binding iron/sulfur cluster: W8 (= W23), C9 (= C24), C12 (= C27), C43 (= C58), C194 (= C206), T196 (≠ V208), Y197 (= Y209)
- binding thiamine diphosphate: I41 (= I56), G42 (= G57), C43 (= C58), S44 (= S59), H62 (= H75), G86 (= G99), G88 (= G101), D89 (= D102), N115 (= N128), V117 (≠ I130), Y118 (= Y131), G119 (= G132), L120 (= L133), T121 (= T134)
Q96Y68 2-oxoacid:ferredoxin oxidoreductase 1, subunit beta; OFOR1; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 2 papers)
47% identity, 55% coverage: 23:211/343 of query aligns to 11:202/305 of Q96Y68
- C12 (= C24) binding
- C15 (= C27) binding
- C46 (= C58) binding
- K49 (≠ R61) mutation to I: Loss of oxidoreductase activity toward 2-oxoglutarate but retains its activity toward pyruvate.
- D90 (= D100) binding
- GD 91:92 (= GD 101:102) binding
- N118 (= N128) binding
- V120 (≠ I130) binding
- GL 122:123 (= GL 132:133) binding
- K125 (= K135) Plays an important role in the binding of CoA; mutation to A: Shows a strong decrease of affinity for CoA and a poor inactivation by 4-fluoro-7-nitrobenzofurazan (NBD-F).
- K173 (= K182) mutation to A: Same oxidoreductase activity as the wild-type.
- C197 (= C206) binding
P72579 2-oxoacid:ferredoxin oxidoreductase subunit beta; OFOR; EC 1.2.7.11 from Sulfolobus sp. (see paper)
46% identity, 57% coverage: 17:211/343 of query aligns to 5:202/305 of P72579
- K49 (≠ R61) mutation to I: Strong decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.; mutation to R: Increase the oxidoreductase activity with pyruvate.; mutation to V: Slight decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.
- L123 (= L133) mutation L->A,I: Strong decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.; mutation to N: Strong decrease of the oxidoreductase activity with pyruvate and 2-oxobutyrate. However, this mutant shows almost the same activity with 2-oxoglutarate as the wild-type.
5b47B 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex (see paper)
45% identity, 55% coverage: 21:209/343 of query aligns to 2:182/275 of 5b47B
- binding magnesium ion: D83 (= D100), N111 (= N128)
- binding iron/sulfur cluster: C5 (= C24), C8 (= C27), C39 (= C58), C179 (= C206)
- binding thiamine diphosphate: I37 (= I56), G38 (= G57), C39 (= C58), S40 (= S59), H58 (= H75), G84 (= G101), D85 (= D102), N111 (= N128), V113 (≠ I130), Y114 (= Y131), L116 (= L133)
5b48B 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai (see paper)
45% identity, 57% coverage: 17:211/343 of query aligns to 1:188/286 of 5b48B
- binding magnesium ion: D84 (= D100), N112 (= N128), V114 (≠ I130)
- binding iron/sulfur cluster: C8 (= C24), C11 (= C27), C42 (= C58), C183 (= C206), T185 (≠ V208)
- binding 2-[(2E)-3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-4-methyl-2-(1-oxidanylpropylidene)-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: I40 (= I56), G41 (= G57), C42 (= C58), S43 (= S59), H59 (= H75), G85 (= G101), D86 (= D102), N112 (= N128), V114 (≠ I130), Y115 (= Y131), G116 (= G132), L117 (= L133)
5exeC Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-tpp adduct (see paper)
26% identity, 45% coverage: 1:156/343 of query aligns to 2:166/314 of 5exeC
- active site: N143 (≠ L133)
- binding [2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-carboxy-4-methyl-1,3-thiazol-3-ium-5-yl]ethoxy-oxidanyl-phosphoryl] hydrogen phosphate: T50 (≠ I56), G51 (= G57), C52 (= C58), I74 (≠ A78), G109 (= G99), D110 (= D100), G111 (= G101), Y136 (≠ F126), N138 (= N128), S140 (≠ I130), Y141 (= Y131), A142 (≠ G132), N143 (≠ L133), T144 (= T134)
- binding magnesium ion: D110 (= D100), D130 (≠ N120), N138 (= N128), S140 (≠ I130)
- binding iron/sulfur cluster: C24 (= C24), C27 (= C27), P29 (≠ D29), C52 (= C58)
Sites not aligning to the query:
5exdF Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-di-oxido-methyl-tpp (coom-tpp) intermediate (see paper)
26% identity, 45% coverage: 1:156/343 of query aligns to 2:166/310 of 5exdF
- active site: N143 (≠ L133)
- binding magnesium ion: D110 (= D100), N138 (= N128), S140 (≠ I130)
- binding [2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-4-methyl-2-[1,1,2-tris(oxidanyl)-2-oxidanylidene-ethyl]-1,3-thiazol-3-ium-5-yl]ethoxy-oxidanyl-phosphoryl] hydrogen phosphate: T50 (≠ I56), G51 (= G57), C52 (= C58), I74 (≠ A78), D110 (= D100), G111 (= G101), Y136 (≠ F126), N138 (= N128), S140 (≠ I130), Y141 (= Y131), A142 (≠ G132), N143 (≠ L133), T144 (= T134)
- binding iron/sulfur cluster: C24 (= C24), C27 (= C27), P29 (≠ D29), C52 (= C58), A142 (≠ G132)
Sites not aligning to the query:
5c4iC Structure of an oxalate oxidoreductase (see paper)
26% identity, 45% coverage: 1:156/343 of query aligns to 2:166/312 of 5c4iC
- active site: N143 (≠ L133)
- binding magnesium ion: D110 (= D100), N138 (= N128), S140 (≠ I130)
- binding iron/sulfur cluster: C24 (= C24), C27 (= C27), P29 (≠ D29), C52 (= C58), A142 (≠ G132)
- binding thiamine diphosphate: T50 (≠ I56), G51 (= G57), C52 (= C58), I74 (≠ A78), G109 (= G99), D110 (= D100), G111 (= G101), Y136 (≠ F126), N138 (= N128), S140 (≠ I130), Y141 (= Y131), A142 (≠ G132), N143 (≠ L133), T144 (= T134)
Sites not aligning to the query:
6cioA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with lactyl-tpp bound (see paper)
27% identity, 33% coverage: 94:207/343 of query aligns to 960:1075/1164 of 6cioA
- active site: N999 (≠ L133)
- binding magnesium ion: D966 (= D100), T994 (≠ N128), V996 (≠ I130)
- binding iron/sulfur cluster: C1074 (= C206), I1075 (= I207)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-carboxy-1-hydroxyethyl)-5-(2-{[hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: G965 (= G99), D966 (= D100), G967 (= G101), V996 (≠ I130), Y997 (= Y131), S998 (≠ G132), N999 (≠ L133), T1000 (= T134)
Sites not aligning to the query:
- active site: 28, 61, 111
- binding iron/sulfur cluster: 455, 678, 680, 685, 686, 688, 689, 691, 695, 699, 700, 734, 741, 742, 744, 745, 747, 751, 757, 758, 807, 808, 811, 813, 836
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-carboxy-1-hydroxyethyl)-5-(2-{[hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: 26, 27, 28, 61, 85, 111, 813, 834, 835, 836, 865
6cipA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with acetyl-tpp bound (see paper)
27% identity, 33% coverage: 94:207/343 of query aligns to 960:1075/1165 of 6cipA
Sites not aligning to the query:
- active site: 28, 61, 111
- binding 2-acetyl-thiamine diphosphate: 27, 61, 85, 111, 813, 834, 835, 836, 865
- binding iron/sulfur cluster: 455, 678, 680, 685, 686, 688, 689, 691, 695, 699, 700, 734, 741, 742, 744, 745, 747, 751, 757, 758, 807, 808, 811, 813, 836
6ciqA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with coenzyme a bound (see paper)
27% identity, 33% coverage: 94:207/343 of query aligns to 960:1075/1169 of 6ciqA
- active site: N999 (≠ L133)
- binding coenzyme a: N999 (≠ L133)
- binding magnesium ion: D966 (= D100), T994 (≠ N128), V996 (≠ I130)
- binding iron/sulfur cluster: S998 (≠ G132), C1074 (= C206), I1075 (= I207)
- binding thiamine diphosphate: G965 (= G99), D966 (= D100), G967 (= G101), V996 (≠ I130), Y997 (= Y131), S998 (≠ G132), N999 (≠ L133), T1000 (= T134)
Sites not aligning to the query:
- active site: 28, 61, 111
- binding coenzyme a: 28, 423, 424, 427, 428, 553, 586
- binding iron/sulfur cluster: 678, 680, 685, 686, 688, 689, 691, 695, 696, 700, 734, 741, 742, 743, 744, 745, 747, 751, 757, 807, 808, 811, 813, 836
- binding thiamine diphosphate: 26, 27, 61, 85, 813, 835, 836, 865
6cinB Crystal structure of pyruvate:ferredoxin oxidoreductase from moorella thermoacetica (see paper)
27% identity, 33% coverage: 94:207/343 of query aligns to 960:1075/1169 of 6cinB
- active site: N999 (≠ L133)
- binding magnesium ion: D966 (= D100), T994 (≠ N128), V996 (≠ I130)
- binding iron/sulfur cluster: S998 (≠ G132), C1074 (= C206), I1075 (= I207)
- binding thiamine diphosphate: G965 (= G99), D966 (= D100), G967 (= G101), V996 (≠ I130), Y997 (= Y131), S998 (≠ G132), N999 (≠ L133), T1000 (= T134)
Sites not aligning to the query:
- active site: 28, 61, 111
- binding iron/sulfur cluster: 455, 678, 685, 686, 687, 688, 689, 691, 695, 700, 741, 742, 743, 744, 745, 746, 747, 751, 752, 757, 758, 807, 808, 811, 813, 836
- binding thiamine diphosphate: 26, 27, 61, 834, 835, 836, 865
Q2RMD6 Pyruvate:ferredoxin oxidoreductase; PFOR; Pyruvate synthase; EC 1.2.7.1 from Moorella thermoacetica (strain ATCC 39073 / JCM 9320) (see paper)
27% identity, 33% coverage: 94:207/343 of query aligns to 961:1076/1171 of Q2RMD6
Sites not aligning to the query:
- 424:428 binding
- 456 binding
- 556 binding
- 598 binding
- 686 binding
- 689 binding
- 692 binding
- 696 binding
- 742 binding
- 745 binding
- 748 binding
- 752 binding
- 809 binding
- 812 binding
- 814 binding
- 837 binding ; binding
Query Sequence
>Ga0059261_0324 FitnessBrowser__Korea:Ga0059261_0324
VNEITTIKPSTPKDWETDQEVRWCPGCGDYAILKAVQRTMPEIGATPENTVFISGIGCSS
RFPYYMETYGFHTIHGRAPAVATGVKLANPDLDVWIITGDGDGLSIGGNHTMHLLRRNLN
CQVLLFNNEIYGLTKGQYSPTSREGTRSPSTPFGSVDHPAKPCAYALGSGARFIARGIDV
HKNLPSVLKAAHAHQGAAFVEIFQNCIVYNDDVFAPFTEKANAGNQLWLEHGQPMLFAGG
SKGIALDTERLTLKTVDVVEGNWQAAGVIVHNVSNRAIAHMLVEMPFGPFPMALGVLYDD
PAPTFESAVVAQNLAASEGKVPDLQKLVSKGQTWMVDKEPHPM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory