Comparing Ga0059261_0351 FitnessBrowser__Korea:Ga0059261_0351 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
7npjB Crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine
28% identity, 88% coverage: 36:308/310 of query aligns to 58:337/344 of 7npjB
Sites not aligning to the query:
7nphC Crystal structure of mycobacterium tuberculosis argc in complex with 5-methoxy-1,3-benzoxazole-2-carboxylic acid
28% identity, 88% coverage: 36:308/310 of query aligns to 58:337/344 of 7nphC
Sites not aligning to the query:
7notA Crystal structure of mycobacterium tuberculosis argc in complex with nicotinamide adenine dinucleotide phosphate (NADP+) and 5-methoxy-3- indoleacetic acid
28% identity, 88% coverage: 36:308/310 of query aligns to 58:337/344 of 7notA
7nnrA Crystal structure of mycobacterium tuberculosis argc in complex with xanthene-9-carboxylic acid
28% identity, 88% coverage: 36:308/310 of query aligns to 58:337/344 of 7nnrA
2i3gA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis in complex with NADP+. (see paper)
28% identity, 88% coverage: 36:308/310 of query aligns to 61:340/347 of 2i3gA
Sites not aligning to the query:
2ozpA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (ttha1904) from thermus thermophilus
23% identity, 85% coverage: 46:308/310 of query aligns to 61:335/342 of 2ozpA
Sites not aligning to the query:
>Ga0059261_0351 FitnessBrowser__Korea:Ga0059261_0351
MSVSVFIDGAAGTTGLEIRERLATRSDISLIGLDDAHRKDAGKRAEAINSADFVILCLPD
DAAREAVALIANDTTRVIDASTAHRVADGWTYGFAELEPAQAAAIAEARYVSNPGCWPTG
FLALVRPLVRAGLIPPDWVLTAGGASGYSGGGKSMIAEFEDGSEPTGFRAYGLDLEHKHL
PEMQKHARIDHAPIFQPAVARSYRGMLIEVPLPLQMLPRKPAPAQIEQVLADAYRDSPIV
RVLPSDDVSLVRIEDDAGTDRLTIRVFGNAERGQARLVATLDNLGKGAGGAAVQNLNIMA
GFDQTAGLVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory