Comparing Ga0059261_0355 FitnessBrowser__Korea:Ga0059261_0355 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
1sz2B Crystal structure of e. Coli glucokinase in complex with glucose (see paper)
34% identity, 97% coverage: 7:319/323 of query aligns to 8:314/320 of 1sz2B
8dtcA Crystal structure of glucokinase with bound glucose from acanthamoeba castellanii
25% identity, 99% coverage: 4:322/323 of query aligns to 27:359/374 of 8dtcA
>Ga0059261_0355 FitnessBrowser__Korea:Ga0059261_0355
VEVVAVDIGGTHARFAIAEVEGGRVVSIGEPVTQKTAEHGSFQLAWQASARALGREMPRA
AAIAIASPINDELIKLTNNPWIIRPPLIKERLEVDSYSLINDFGAVGHAVAQLPSEHFLH
ICGPDAPFAEKGAITVCGPGTGLGVAQVFRTGPLSYHVISTEGGHMDFAPLDGIEDSIVK
RLRSTYTRVSAERIVAGPGIVPIYETLAEIEGKRTHRLNDKEIWTLAFEGKDSLAMAALD
RFCLSLGAVAGDLALAHGPTGVVIAGGLGLKLKDHLVNSGFGQRFIAKGRFQALMSSIPV
KLITHPQPGLYGAAAAYAQEHTQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory