SitesBLAST
Comparing Ga0059261_0425 FitnessBrowser__Korea:Ga0059261_0425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
40% identity, 92% coverage: 9:333/353 of query aligns to 1:329/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (= Y141), R144 (= R152), Q145 (≠ D153), Y146 (= Y154), S147 (= S155), H161 (≠ Y168), V162 (≠ I169), V165 (≠ I172), G168 (= G175), V169 (≠ K176), A170 (= A177), T171 (≠ S178), T214 (≠ S217), F329 (= F333)
- binding fe2/s2 (inorganic) cluster: C34 (= C42), N35 (≠ R43), G37 (= G45), C39 (= C47), G40 (= G48), C42 (= C50), C74 (= C82)
Sites not aligning to the query:
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
40% identity, 92% coverage: 9:333/353 of query aligns to 2:330/334 of P0DPQ8
Sites not aligning to the query:
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
30% identity, 90% coverage: 17:333/353 of query aligns to 15:334/337 of 1krhA
- active site: C306 (≠ A305)
- binding flavin-adenine dinucleotide: Y143 (= Y141), R155 (= R152), S156 (≠ D153), Y157 (= Y154), S158 (= S155), V171 (≠ Y168), V172 (≠ I169), G178 (= G175), K179 (= K176), M180 (≠ A177), S181 (= S178), T219 (≠ S217), E332 (≠ D331), F334 (= F333)
- binding fe2/s2 (inorganic) cluster: M38 (≠ H40), D39 (≠ G41), C40 (= C42), R41 (= R43), G43 (= G45), C45 (= C47), G46 (= G48), C48 (= C50), C82 (= C82)
Sites not aligning to the query:
4wqmA Structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant (see paper)
33% identity, 88% coverage: 24:334/353 of query aligns to 18:326/326 of 4wqmA
- binding flavin-adenine dinucleotide: C36 (= C42), S38 (= S44), W57 (≠ A63), Y135 (= Y141), R146 (= R152), A147 (≠ D153), Y148 (= Y154), S149 (= S155), I162 (≠ Y168), V163 (≠ I169), G169 (= G175), K170 (= K176), V171 (≠ A177), S172 (= S178), S209 (= S217), F325 (= F333)
- binding fe2/s2 (inorganic) cluster: Y34 (≠ H40), C36 (= C42), N37 (≠ R43), G39 (= G45), C41 (= C47), G42 (= G48), C44 (= C50), C76 (= C82)
Q03304 Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component; T4MO; Ferredoxin--NAD(+) reductase; Toluene-4-monooxygenase systme, electron transfer component; EC 1.18.1.3 from Pseudomonas mendocina (see paper)
33% identity, 88% coverage: 26:334/353 of query aligns to 20:326/326 of Q03304
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
30% identity, 90% coverage: 18:334/353 of query aligns to 16:334/334 of 7c3bC
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
30% identity, 90% coverage: 18:334/353 of query aligns to 15:321/321 of 7c3aA
- binding flavin-adenine dinucleotide: C39 (= C42), S41 (= S44), W60 (≠ A63), R152 (= R152), A153 (≠ D153), Y154 (= Y154), S155 (= S155), Y169 (= Y168), I170 (= I169), G176 (= G175), R177 (≠ K176), F178 (≠ A177), S179 (= S178), A218 (≠ S217), F320 (= F333), F321 (= F334)
- binding fe2/s2 (inorganic) cluster: Y37 (≠ H40), C39 (= C42), A40 (≠ R43), G42 (= G45), C44 (= C47), G45 (= G48), C47 (= C50), C80 (= C82)
7c3bB Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
30% identity, 90% coverage: 18:334/353 of query aligns to 15:306/306 of 7c3bB
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
32% identity, 65% coverage: 105:334/353 of query aligns to 8:245/250 of 1tvcA
- active site: Y63 (= Y154), S64 (= S155), L215 (= L304)
- binding dihydroflavine-adenine dinucleotide: N24 (= N123), F49 (≠ Y141), R61 (= R152), S62 (≠ D153), Y63 (= Y154), S64 (= S155), L78 (≠ Y168), I79 (= I169), R80 (= R170), L82 (≠ I172), F87 (≠ A177), G128 (= G218), N155 (≠ R245), E159 (≠ D249), S186 (= S276), G187 (≠ D277), E242 (≠ D331), F244 (= F333), L245 (≠ F334)
7qu0A X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
26% identity, 65% coverage: 104:333/353 of query aligns to 2:279/279 of 7qu0A
- binding ~{N}-[2,6-bis(fluoranyl)phenyl]ethanamide: S213 (= S273), F227 (= F285), M256 (= M310)
- binding flavin-adenine dinucleotide: Y40 (= Y141), R83 (= R152), A84 (≠ D153), Y85 (= Y154), S86 (= S155), A104 (vs. gap), T105 (vs. gap), P106 (vs. gap), P107 (vs. gap), A113 (vs. gap), P114 (= P173), P115 (≠ G174), G116 (= G175), I117 (≠ K176), M118 (≠ A177), S119 (= S178), F279 (= F333)
7qtyA X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
26% identity, 65% coverage: 104:333/353 of query aligns to 2:279/279 of 7qtyA
- binding 1-(furan-2-ylmethyl)-3-(2-methylphenyl)thiourea: A184 (= A244), R185 (= R245), S213 (= S273), F227 (= F285), H229 (≠ T287), V255 (≠ A309), M256 (= M310)
- binding flavin-adenine dinucleotide: Y40 (= Y141), R83 (= R152), A84 (≠ D153), Y85 (= Y154), S86 (= S155), N100 (≠ I169), A104 (vs. gap), T105 (vs. gap), P107 (vs. gap), A113 (vs. gap), P114 (= P173), G116 (= G175), I117 (≠ K176), M118 (≠ A177), S119 (= S178), F279 (= F333)
8a1yF Sodium pumping nadh-quinone oxidoreductase with inhibitor hqno (see paper)
23% identity, 80% coverage: 51:333/353 of query aligns to 80:406/408 of 8a1yF
- binding flavin-adenine dinucleotide: R210 (= R152), A211 (≠ D153), Y212 (= Y154), S213 (= S155), V228 (≠ R170), R229 (≠ H171), A231 (≠ P173), V240 (vs. gap), P241 (vs. gap), G243 (= G175), Q244 (≠ K176), M245 (≠ A177)
- binding fe2/s2 (inorganic) cluster: C111 (= C82)
Sites not aligning to the query:
A5F5Y4 Na(+)-translocating NADH-quinone reductase subunit F; Na(+)-NQR subunit F; Na(+)-translocating NQR subunit F; NQR complex subunit F; NQR-1 subunit F; EC 7.2.1.1 from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) (see paper)
23% identity, 80% coverage: 51:333/353 of query aligns to 80:406/408 of A5F5Y4
- C111 (= C82) binding ; mutation to A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- R210 (= R152) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- Y212 (= Y154) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- S246 (= S178) mutation to A: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
Sites not aligning to the query:
- 70 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- 76 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- 79 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
8a1uF Sodium pumping nadh-quinone oxidoreductase with substrates nadh and q2 (see paper)
23% identity, 80% coverage: 51:333/353 of query aligns to 79:405/405 of 8a1uF
- binding flavin-adenine dinucleotide: Y166 (= Y141), R209 (= R152), A210 (≠ D153), Y211 (= Y154), S212 (= S155), A230 (≠ P173), P233 (vs. gap), V239 (vs. gap), P240 (vs. gap), G242 (= G175), Q243 (≠ K176), M244 (≠ A177), A282 (≠ S217), F405 (= F333)
- binding fe2/s2 (inorganic) cluster: C110 (= C82)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S212 (= S155), R228 (≠ H171), G281 (= G216), A282 (≠ S217), G309 (= G243), R311 (= R245), S339 (= S273), F353 (= F285), C377 (≠ A305), G378 (= G306), P379 (= P307), M381 (≠ A309), M382 (= M310), D403 (= D331)
Sites not aligning to the query:
7qu5A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
26% identity, 52% coverage: 152:333/353 of query aligns to 83:278/280 of 7qu5A
- binding flavin-adenine dinucleotide: R83 (= R152), A84 (≠ D153), Y85 (= Y154), S86 (= S155), N100 (≠ Y168), A104 (vs. gap), L112 (≠ I172), P113 (= P173), G115 (= G175), Q116 (≠ K176), M117 (≠ A177), S118 (= S178), A155 (≠ S217), F278 (= F333)
- binding gamma-Valerolactone: S105 (vs. gap), P108 (vs. gap), D196 (≠ E257), W207 (≠ F268), H208 (≠ E269), L209 (≠ P270)
Sites not aligning to the query:
7qu3A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
26% identity, 52% coverage: 152:333/353 of query aligns to 83:278/279 of 7qu3A
- binding flavin-adenine dinucleotide: R83 (= R152), A84 (≠ D153), Y85 (= Y154), S86 (= S155), N100 (≠ Y168), A104 (vs. gap), S105 (vs. gap), L112 (≠ I172), P113 (= P173), G115 (= G175), Q116 (≠ K176), M117 (≠ A177), S118 (= S178), A155 (≠ S217), F278 (= F333)
- binding 4-(benzimidazol-1-ylmethyl)benzenecarbonitrile: R102 (= R170), G154 (= G216), G182 (= G243), F226 (= F285), I227 (≠ V286), P252 (= P307), M255 (= M310)
Sites not aligning to the query:
4u9uA Crystal structure of nqrf fad-binding domain from vibrio cholerae (see paper)
27% identity, 52% coverage: 152:333/353 of query aligns to 81:277/279 of 4u9uA
- binding flavin-adenine dinucleotide: R81 (= R152), A82 (≠ D153), Y83 (= Y154), S84 (= S155), N98 (≠ I169), A102 (vs. gap), T103 (vs. gap), P104 (vs. gap), V111 (vs. gap), P112 (= P173), G114 (= G175), Q115 (≠ K176), M116 (≠ A177), S117 (= S178), F277 (= F333)
- binding magnesium ion: R186 (≠ A248), M188 (≠ L250)
- binding sodium ion: A198 (= A260), N201 (≠ H263), D202 (≠ A264), F204 (= F266)
Sites not aligning to the query:
7romA Crystal structure of saccharomyces cerevisiae nadh-cytochrome b5 reductase 1 (cbr1) fragment (residues 28-284) bound to fad
25% identity, 46% coverage: 151:311/353 of query aligns to 60:227/255 of 7romA
- binding flavin-adenine dinucleotide: R61 (= R152), S62 (≠ D153), Y63 (= Y154), T64 (≠ S155), L79 (≠ Y168), V80 (≠ I169), Y83 (≠ I172), T85 (≠ G174), G86 (= G175), N87 (≠ K176), V88 (≠ A177), S89 (= S178), T127 (≠ S217), A130 (= A220)
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
25% identity, 58% coverage: 131:333/353 of query aligns to 179:396/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R152), Q207 (≠ D153), Y208 (= Y154), S209 (= S155), S222 (≠ Y168), V223 (≠ I169), K224 (≠ R170), E226 (vs. gap), P232 (= P173), G234 (= G175), Y235 (≠ K176), V236 (≠ A177), S237 (= S178), V276 (≠ S217), T279 (≠ A220), V395 (≠ I332), F396 (= F333)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98, 126, 130, 133
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102, 398
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
25% identity, 58% coverage: 131:333/353 of query aligns to 179:396/403 of 3ozvA
- binding flavin-adenine dinucleotide: R206 (= R152), Q207 (≠ D153), Y208 (= Y154), S209 (= S155), S222 (≠ Y168), V223 (≠ I169), K224 (≠ R170), E226 (vs. gap), P232 (= P173), G234 (= G175), Y235 (≠ K176), V236 (≠ A177), S237 (= S178), V276 (≠ S217), T279 (≠ A220), F396 (= F333)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 24, 28, 57, 102, 106
- binding flavin-adenine dinucleotide: 44, 46, 48
- binding protoporphyrin ix containing fe: 43, 81, 84, 85, 88, 90, 94, 95, 98, 126, 130, 133
Query Sequence
>Ga0059261_0425 FitnessBrowser__Korea:Ga0059261_0425
VNGIVVTRTVHIRQTGRPIAVGDKQTILAAALDAGVAFPHGCRSGRCGACKSRLLSGEVD
LLAHTRFALTAEEKAQGLILACRAQPLTDIEVAWLGEAEIIEHPVRSLKAEVVALDSATH
DINLVRVRVAGEPLVFTAGQYAQLSAAGAPTRDYSMANVPGEEDLEFYIRHIPGGKASER
IATHLAVGDTLTLRGPFGSAYLREGHTGPILAVAGGSGLAPIKAIVETALEKGLRQPIHL
YFGARRRADLYLVDHFERLAAAHANFHFEPVLSRESDAGAGRAGFVTDAIAADFTDLDGW
KAYLAGPPAMIDTAGPLLKARGLASEDFHADIFFTPEPPLREDLRQTTEGAAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory