Comparing Ga0059261_0494 FitnessBrowser__Korea:Ga0059261_0494 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
37% identity, 89% coverage: 11:204/218 of query aligns to 12:208/226 of 5xu1B
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
41% identity, 79% coverage: 30:201/218 of query aligns to 35:208/233 of P75957
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 96% coverage: 5:213/218 of query aligns to 4:217/330 of P9WQK5
7arlD Lolcde in complex with lipoprotein and adp (see paper)
41% identity, 79% coverage: 30:201/218 of query aligns to 32:205/222 of 7arlD
7mdyC Lolcde nucleotide-bound
41% identity, 79% coverage: 30:201/218 of query aligns to 32:205/226 of 7mdyC
Sites not aligning to the query:
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
40% identity, 79% coverage: 30:201/218 of query aligns to 34:207/229 of 7v8iD
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
35% identity, 89% coverage: 11:204/218 of query aligns to 10:211/232 of 1f3oA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
35% identity, 91% coverage: 4:201/218 of query aligns to 3:201/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
35% identity, 91% coverage: 4:201/218 of query aligns to 3:201/230 of 6z4wA
A0A0H2ZM82 Cell division ATP-binding protein FtsE from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
35% identity, 91% coverage: 4:201/218 of query aligns to 3:201/230 of A0A0H2ZM82
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
34% identity, 89% coverage: 11:204/218 of query aligns to 10:211/230 of 1l2tA
3d31A Modbc from methanosarcina acetivorans (see paper)
37% identity, 92% coverage: 4:203/218 of query aligns to 1:195/348 of 3d31A
Sites not aligning to the query:
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
36% identity, 92% coverage: 3:203/218 of query aligns to 2:207/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
36% identity, 92% coverage: 3:203/218 of query aligns to 2:207/592 of 5lj7A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
35% identity, 84% coverage: 16:198/218 of query aligns to 15:198/223 of 2pclA
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
35% identity, 91% coverage: 4:201/218 of query aligns to 4:206/650 of 5ws4A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
37% identity, 87% coverage: 9:198/218 of query aligns to 10:200/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
37% identity, 87% coverage: 9:198/218 of query aligns to 10:200/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
37% identity, 87% coverage: 9:198/218 of query aligns to 10:200/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
37% identity, 87% coverage: 9:198/218 of query aligns to 10:200/353 of Q97UY8
>Ga0059261_0494 FitnessBrowser__Korea:Ga0059261_0494
MPRVLEISSLTFRYGGQAVVDGFDLVQEPGDHRVLLGPSGSGKTTLINLIAGLLTPQSGR
IMIDGESIGDLPAAKRDDLRRRKIGVVFQTLRLVAALDVTANLMLAQRLAGQRPDRGEIQ
ALLAALDLTHRAHARPRELSQGEAQRAAIARGLVAHPKLLIADEPTSALDDCNAERVAQL
LIETANTHGSTLLVATHDARIKAFIPDAVTLAPVREAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory