Comparing Ga0059261_0499 FitnessBrowser__Korea:Ga0059261_0499 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qg4A Apo crystal structure of a mutant of sn243 (d415n) (see paper)
30% identity, 76% coverage: 15:487/622 of query aligns to 20:519/746 of 7qg4A
Sites not aligning to the query:
7qe2A Crystal structure of d-glucuronic acid bound to sn243 (see paper)
30% identity, 76% coverage: 15:487/622 of query aligns to 20:510/737 of 7qe2A
Sites not aligning to the query:
7qeeA Sn243 mutant d415n bound to para-nitrophenyl-beta-d-glucuronide (see paper)
30% identity, 76% coverage: 15:487/622 of query aligns to 20:510/737 of 7qeeA
Sites not aligning to the query:
7qeaA Crystal structure of fluorescein-di-beta-d-glucuronide bound to a mutant of sn243 (d415a) (see paper)
30% identity, 76% coverage: 15:487/622 of query aligns to 20:510/737 of 7qeaA
Sites not aligning to the query:
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
28% identity, 92% coverage: 24:597/622 of query aligns to 1:573/753 of 7zgzX
7zb3A Crystal structure of beta-xylosidase from thermotoga maritima in complex with xylohexaose hydrolysed to xylobiose
32% identity, 73% coverage: 24:480/622 of query aligns to 1:409/765 of 7zb3A
Sites not aligning to the query:
7zdyW Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside
32% identity, 73% coverage: 24:480/622 of query aligns to 1:409/763 of 7zdyW
Sites not aligning to the query:
8c7fA Crystal structure of beta-xylosidase mutant (d281n, e517q) from thermotoga maritima in complex with xylopentaose
31% identity, 73% coverage: 24:480/622 of query aligns to 1:409/772 of 8c7fA
Sites not aligning to the query:
5jp0A Bacteroides ovatus xyloglucan pul gh3b with bound glucose (see paper)
24% identity, 91% coverage: 29:596/622 of query aligns to 1:593/745 of 5jp0A
Sites not aligning to the query:
5m6gA Crystal structure glucan 1,4-beta-glucosidase from saccharopolyspora erythraea
28% identity, 92% coverage: 27:601/622 of query aligns to 4:558/579 of 5m6gA
Sites not aligning to the query:
5z9sA Functional and structural characterization of a beta-glucosidase involved in saponin metabolism from intestinal bacteria (see paper)
30% identity, 68% coverage: 37:460/622 of query aligns to 4:372/765 of 5z9sA
Sites not aligning to the query:
6jg2A Crystal structure of barley exohydrolasei wildtype in complex with 4'- nitrophenyl thiolaminaribioside (see paper)
25% identity, 95% coverage: 27:620/622 of query aligns to 7:598/603 of 6jg2A
6jg1A Crystal structure of barley exohydrolasei wildtype in complex with 4i, 4iii,4v-s-trithiocellohexaose (see paper)
25% identity, 95% coverage: 27:620/622 of query aligns to 9:601/606 of 6jg1A
3wlpA Crystal structure analysis of plant exohydrolase (see paper)
25% identity, 95% coverage: 27:620/622 of query aligns to 5:597/602 of 3wlpA
3wljA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 3-deoxy-glucose (see paper)
25% identity, 95% coverage: 27:620/622 of query aligns to 5:597/602 of 3wljA
1x39A Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole (see paper)
25% identity, 95% coverage: 27:620/622 of query aligns to 5:597/602 of 1x39A
1x38A Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole (see paper)
25% identity, 95% coverage: 27:620/622 of query aligns to 5:597/602 of 1x38A
1lq2A Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole (see paper)
25% identity, 95% coverage: 27:620/622 of query aligns to 5:597/602 of 1lq2A
1j8vA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 4'-nitrophenyl 3i-thiolaminaritrioside (see paper)
25% identity, 95% coverage: 27:620/622 of query aligns to 5:597/602 of 1j8vA
1iewA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 2-deoxy-2-fluoro-alpha-d-glucoside (see paper)
25% identity, 95% coverage: 27:620/622 of query aligns to 5:597/602 of 1iewA
>Ga0059261_0499 FitnessBrowser__Korea:Ga0059261_0499
MLALSGAAPPELAAYRDLNRNGVMDPYENPALPVDARVDDLLARMTPEEKAGQLLHGTLP
GHGSAIGASTSGYDLDKARAMIADQHVSSFITRLVMPPAQFAEQNNAVQKLAEATRLGIP
ATISTDPRHHFHATAGASTHGGGFSQWPETLAFAAIGDPALVRRFGEAARREYRAVGIHM
ALSPQADIGSEPRWPRITATFGSDPATVSRLAGAYVEGFQGGPSGVTRDGVATVVKHWVG
YGAAPEGHDGHNFYGRAVSMTDAEFEKHVAAFDGAFAVRSAGVMPTYVIVRGPRLKGAAL
EPVGAGFSKQLLNDLLRREKGYGGLIISDWAITRDCDAACTAPDASNPQLPGSIGMPWGV
EHLSVTERFAKGLEAGLDQFGGVDDPAPILAVMREGKVDAARIDASVRRILRLKFELGLF
ENPFVDPARAEAVLGDPGVRAQADAAQRAGQVLLRNQGALLPLRRGARLWLHGVDADAAR
AAGFQVVGKPEEADAALVRTATPFETLHPHHFFGSRQHEGRLDFRPDDADTKTIAAAARH
VPVIVAVEMDRPAILTALLPHSRALLVTFGASDAALLDVVQGVAKPRGKLPFDLPRSMED
VGKHRGGDDCCAQFRRGEGLQL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory