Comparing Ga0059261_0523 FitnessBrowser__Korea:Ga0059261_0523 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
6p3hC Crystal structure of ligu(k66m) bound to substrate (see paper)
79% identity, 99% coverage: 3:350/351 of query aligns to 3:350/352 of 6p3hC
6p3jB Crystal structure of ligu (see paper)
78% identity, 99% coverage: 3:350/351 of query aligns to 8:347/352 of 6p3jB
Sites not aligning to the query:
5k87A Crystal structure of malonate bound to methylaconitate isomerase prpf from shewanella oneidensis (see paper)
38% identity, 98% coverage: 5:349/351 of query aligns to 8:384/389 of 5k87A
2pvzA Crystal structure of methylaconitate isomerase prpf from shewanella oneidensis (see paper)
38% identity, 98% coverage: 5:349/351 of query aligns to 8:382/387 of 2pvzA
Q8EJW4 2-methyl-aconitate isomerase; Cis-trans isomerase; EC 5.3.3.- from Shewanella oneidensis (strain MR-1) (see paper)
38% identity, 98% coverage: 5:349/351 of query aligns to 12:392/397 of Q8EJW4
2pw0A Crystal structure of trans-aconitate bound to methylaconitate isomerase prpf from shewanella oneidensis (see paper)
38% identity, 98% coverage: 5:349/351 of query aligns to 7:380/385 of 2pw0A
2pw0B Crystal structure of trans-aconitate bound to methylaconitate isomerase prpf from shewanella oneidensis (see paper)
36% identity, 98% coverage: 5:349/351 of query aligns to 8:336/341 of 2pw0B
>Ga0059261_0523 FitnessBrowser__Korea:Ga0059261_0523
MSDGIRCMWMRGGTSKGGYFLKEDLPADTAARDALLLRVMGSPDPRQIDGMGGADPLTSK
VAVVSKSARDGIDVDYLFLQVFVDQAIVTDAQNCGNILAGIGPFAIERGLVEAQDGETRV
AIFMENTAQVAVATVQTPGGRVRYAGDAAISGVPGTAAPIPLAFRDTAGASCGALLPTGN
GVDEIDGIKVTLIDNGMPCVVIAASDMGITGYEDRDTLDADTAMKARVEAIRLKAGPLMN
LGDVIEKSVPKMMLVAPPRDGGAIAVRSLIPHRVHASIGVLGAVSVATACLIEGSPAAAL
AQVPAGGTRTLGVEHPTGVTECVVTVDANGAPVEAGMLRTARKLMDGKVFA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory