Comparing Ga0059261_0528 FitnessBrowser__Korea:Ga0059261_0528 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
3wkuA Crystal structure of the anaerobic desb-gallate complex (see paper)
29% identity, 78% coverage: 11:116/136 of query aligns to 292:397/407 of 3wkuA
Sites not aligning to the query:
3wr9A Crystal structure of the anaerobic desb-gallate complex (see paper)
29% identity, 78% coverage: 11:116/136 of query aligns to 297:402/416 of 3wr9A
Sites not aligning to the query:
>Ga0059261_0528 FitnessBrowser__Korea:Ga0059261_0528
MNGPKDIHSYLAEFEDIPGTRVFTASRARQGYHLNQFAMSLMKPENRKRWKANERAYLDE
WPLSDAQKAALLARDYNTLLDLGGNIYFLSKVFSTDGLSFVQAVSTMTGVSVEDYQAMMK
AGGRSPEGNRSKRERR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory