SitesBLAST
Comparing Ga0059261_0530 FitnessBrowser__Korea:Ga0059261_0530 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3q2iA Crystal structure of the wlba dehydrognase from chromobactrium violaceum in complex with nadh and udp-glcnaca at 1.50 a resolution (see paper)
25% identity, 72% coverage: 1:227/315 of query aligns to 12:242/345 of 3q2iA
- active site: K104 (≠ I93), H192 (= H177)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: K104 (≠ I93), N133 (≠ R122), T164 (≠ F152), R165 (= R153), Y169 (≠ N156), N188 (≠ H173), Q189 (≠ H174), H192 (= H177)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C19 (≠ A8), G20 (= G9), R21 (≠ A10), I22 (≠ F11), D44 (≠ G32), I45 (≠ R33), T81 (= T70), P82 (= P71), S83 (≠ T72), H86 (= H75), E103 (= E92), K104 (≠ I93), Q132 (≠ T121), W175 (≠ E162), R176 (≠ A163), H192 (= H177)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 247, 248
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
25% identity, 60% coverage: 1:189/315 of query aligns to 8:200/347 of 3q2kC
- active site: K100 (≠ I93), H188 (= H177)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ A10), K100 (≠ I93), W159 (≠ F151), T160 (≠ F152), R161 (= R153), Y165 (≠ M157), N184 (≠ H173), Q185 (≠ H174), H188 (= H177)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G9), R17 (≠ A10), I18 (≠ F11), D40 (≠ G32), T41 (≠ R33), A76 (≠ C69), T77 (= T70), S79 (≠ T72), H82 (= H75), Q85 (= Q78), E99 (= E92), K100 (≠ I93), Q128 (≠ T121), W171 (≠ A163), R172 (= R164)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 243, 244
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
25% identity, 60% coverage: 1:189/315 of query aligns to 3:195/322 of 3q2kK
- active site: K95 (≠ I93), H183 (= H177)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ A10), K95 (≠ I93), T155 (≠ F152), R156 (= R153), Y160 (≠ M157), N179 (≠ H173), Q180 (≠ H174), H183 (= H177)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G7), G11 (= G9), R12 (≠ A10), I13 (≠ F11), D35 (≠ G32), T36 (≠ R33), T72 (= T70), P73 (= P71), S74 (≠ T72), L76 (≠ M74), H77 (= H75), E94 (= E92), K95 (≠ I93), Q123 (≠ T121), W166 (≠ A163), R167 (= R164), H183 (= H177)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 239
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
31% identity, 44% coverage: 1:140/315 of query aligns to 2:141/333 of 4koaA
- active site: K94 (≠ I93)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), A9 (= A8), S10 (≠ G9), T11 (≠ A10), I12 (≠ F11), S33 (≠ G32), S34 (≠ R33), R38 (≠ P37), T71 (= T70), N73 (≠ T72), H76 (= H75), K94 (≠ I93)
Sites not aligning to the query:
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
24% identity, 83% coverage: 1:261/315 of query aligns to 4:251/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (= H120), Q173 (≠ H174), H176 (= H177), E242 (≠ D252), M243 (≠ L253)
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G12 (= G9), R13 (≠ A10), A14 (≠ F11), D35 (≠ G32), P36 (≠ R33), R37 (= R34), A71 (≠ C69), S72 (≠ T70), P73 (= P71), F76 (≠ M74), Q80 (= Q78), E94 (= E92), K95 (≠ I93), P96 (= P94), R161 (≠ K155), P163 (≠ M157), E164 (≠ N158)
Sites not aligning to the query:
3m2tA The crystal structure of dehydrogenase from chromobacterium violaceum
23% identity, 97% coverage: 1:307/315 of query aligns to 4:324/342 of 3m2tA
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G12 (= G9), A13 (= A10), Q14 (vs. gap), D36 (≠ G32), S37 (≠ R33), R41 (≠ P37), A73 (≠ C69), G74 (≠ T70), L78 (≠ M74), E96 (= E92), K97 (≠ I93), N125 (≠ T121), Y290 (≠ I273)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
28% identity, 44% coverage: 2:140/315 of query aligns to 2:140/332 of 2glxA
- active site: K93 (≠ I93)
- binding acetate ion: K93 (≠ I93)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G7), A8 (= A8), S9 (≠ G9), T10 (≠ A10), I11 (≠ F11), S32 (≠ G32), T33 (≠ R33), R37 (≠ P37), S69 (≠ C69), T70 (= T70), N72 (≠ T72), H75 (= H75), E92 (= E92), K93 (≠ I93), H121 (≠ T121)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
28% identity, 44% coverage: 2:140/315 of query aligns to 3:141/333 of Q2I8V6
- ASTI 9:12 (≠ AGAF 8:11) binding
- S10 (≠ G9) mutation to G: Almost no effect.
- A13 (≠ G12) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ G32) mutation to D: No activity.
- ST 33:34 (≠ GR 32:33) binding
- R38 (≠ P37) binding
- TTNELH 71:76 (≠ TPTQMH 70:75) binding
- EK 93:94 (≠ EI 92:93) binding
- K94 (≠ I93) mutation to G: Less than 1% remaining activity.
- N120 (≠ G119) binding
Sites not aligning to the query:
- 162:163 binding
- 176 D→A: Less than 1% remaining activity.
- 180 H→A: Less than 2% remaining activity.
- 206 G→I: No effect.
- 283 binding
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
25% identity, 61% coverage: 36:228/315 of query aligns to 40:243/336 of 5a06A
- active site: K101 (≠ I93), Y186 (= Y184)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K41 (≠ P37), Y59 (≠ T51), I77 (≠ C69), T78 (= T70), P79 (= P71), N80 (≠ T72), L82 (≠ M74), H83 (= H75), E100 (= E92), K101 (≠ I93), R129 (≠ T121), W168 (= W166), R169 (≠ T167), Y186 (= Y184)
- binding sorbitol: D72 (= D64), H96 (= H88), K101 (≠ I93), R122 (≠ L114), R122 (≠ L114), L124 (≠ C116), F160 (= F152), R169 (≠ T167), D182 (= D180), Y186 (= Y184)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 11, 12, 13, 14, 36, 37, 38, 264
- binding sorbitol: 2, 287, 296, 299, 306, 310, 311
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
25% identity, 61% coverage: 36:228/315 of query aligns to 40:243/336 of 5a03C
- active site: K101 (≠ I93), Y186 (= Y184)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K41 (≠ P37), Y59 (≠ T51), I77 (≠ C69), T78 (= T70), P79 (= P71), N80 (≠ T72), L82 (≠ M74), H83 (= H75), E100 (= E92), K101 (≠ I93), R129 (≠ T121), W168 (= W166), R169 (≠ T167), Y186 (= Y184)
- binding beta-D-xylopyranose: K101 (≠ I93), F160 (= F152), R169 (≠ T167), D182 (= D180), Y186 (= Y184)
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
25% identity, 61% coverage: 36:228/315 of query aligns to 39:242/335 of 5a05A
- active site: K100 (≠ I93), Y185 (= Y184)
- binding beta-D-glucopyranose: K100 (≠ I93), F159 (= F152), D181 (= D180), Y185 (= Y184)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K40 (≠ P37), Y58 (≠ T51), I76 (≠ C69), T77 (= T70), P78 (= P71), N79 (≠ T72), L81 (≠ M74), H82 (= H75), E99 (= E92), K100 (≠ I93), R128 (≠ T121), W167 (= W166), R168 (≠ T167), Y185 (= Y184)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
25% identity, 61% coverage: 36:228/315 of query aligns to 39:242/335 of 5a04A
- active site: K100 (≠ I93), Y185 (= Y184)
- binding beta-D-glucopyranose: K100 (≠ I93), F159 (= F152), R168 (≠ T167), D181 (= D180), Y185 (= Y184)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K40 (≠ P37), Y58 (≠ T51), I76 (≠ C69), T77 (= T70), P78 (= P71), N79 (≠ T72), L81 (≠ M74), H82 (= H75), E99 (= E92), K100 (≠ I93), R128 (≠ T121), W167 (= W166), R168 (≠ T167), Y185 (= Y184)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
25% identity, 61% coverage: 36:228/315 of query aligns to 39:242/335 of 5a03E
- active site: K100 (≠ I93), Y185 (= Y184)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K40 (≠ P37), Y58 (≠ T51), I76 (≠ C69), T77 (= T70), P78 (= P71), N79 (≠ T72), H82 (= H75), E99 (= E92), K100 (≠ I93), R128 (≠ T121), W167 (= W166), R168 (≠ T167), Y185 (= Y184)
- binding beta-D-xylopyranose: K100 (≠ I93), F159 (= F152), R168 (≠ T167), D181 (= D180), Y185 (= Y184), E205 (= E196), T207 (≠ P198), R209 (≠ H200)
- binding alpha-D-xylopyranose: H134 (≠ S127)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 9, 10, 11, 12, 13, 35, 36, 37, 263
- binding alpha-D-xylopyranose: 268, 279, 280
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
25% identity, 61% coverage: 36:228/315 of query aligns to 39:242/335 of 5a02A
- active site: K100 (≠ I93), Y185 (= Y184)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K40 (≠ P37), Y58 (≠ T51), I76 (≠ C69), T77 (= T70), P78 (= P71), L81 (≠ M74), H82 (= H75), E99 (= E92), K100 (≠ I93), R128 (≠ T121), W167 (= W166), R168 (≠ T167), Y185 (= Y184)
Sites not aligning to the query:
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
25% identity, 58% coverage: 1:182/315 of query aligns to 3:181/336 of 3ec7A
- active site: K97 (≠ I93), H176 (= H177)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), M12 (≠ A10), I13 (≠ F11), D35 (≠ G32), I36 (≠ R33), R40 (≠ P37), T73 (≠ C69), A74 (≠ T70), S75 (≠ P71), N76 (≠ T72), H79 (= H75), E96 (= E92), K97 (≠ I93), M126 (≠ T121)
Sites not aligning to the query:
5b3uB Crystal structure of biliverdin reductase in complex with NADP+ from synechocystis sp. Pcc 6803 (see paper)
25% identity, 54% coverage: 1:169/315 of query aligns to 4:164/317 of 5b3uB
- active site: E94 (= E92), Y95 (≠ I93), E121 (≠ G119), E124 (≠ R122)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T11 (≠ A8), G12 (= G9), Y13 (≠ A10), A14 (≠ F11), N36 (≠ R33), S37 (≠ R34), N40 (≠ P37), A71 (≠ C69), T72 (= T70), I73 (≠ P71), N74 (≠ T72), H77 (= H75), E94 (= E92), Y95 (≠ I93), E121 (≠ G119), W161 (= W166)
Sites not aligning to the query:
5b3vA Crystal structure of biliverdin reductase in complex with biliverdin and NADP+ from synechocystis sp. Pcc 6803 (see paper)
25% identity, 54% coverage: 1:169/315 of query aligns to 3:163/317 of 5b3vA
- active site: E93 (= E92), Y94 (≠ I93), E120 (≠ G119), E123 (≠ R122)
- binding biliverdine ix alpha: Y12 (≠ A10), Y94 (≠ I93), I122 (≠ T121), M151 (≠ N158), Q153 (≠ K160), T161 (= T167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T10 (≠ A8), G11 (= G9), Y12 (≠ A10), A13 (≠ F11), N35 (≠ R33), N39 (≠ P37), A70 (≠ C69), T71 (= T70), I72 (≠ P71), N73 (≠ T72), H76 (= H75), E93 (= E92), Y94 (≠ I93), E120 (≠ G119), W160 (= W166)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
23% identity, 94% coverage: 13:309/315 of query aligns to 18:335/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (≠ I93), R150 (≠ Q143), W157 (≠ Y150), F160 (= F152), D173 (≠ S165), H177 (= H169)
- binding nicotinamide-adenine-dinucleotide: D51 (≠ E53), Y52 (≠ L54), C67 (= C69), T68 (= T70), P69 (= P71), H73 (= H75), E90 (= E92), K91 (≠ I93), P92 (= P94), Q119 (≠ T121), V159 (≠ F151), F160 (= F152), Q166 (≠ N158)
Sites not aligning to the query:
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
23% identity, 71% coverage: 1:223/315 of query aligns to 5:236/342 of 3ceaA
- active site: K98 (≠ I93), H185 (= H177)
- binding nicotinamide-adenine-dinucleotide: G11 (= G7), G13 (= G9), R14 (≠ A10), L15 (≠ F11), L38 (≠ R33), Q42 (≠ P37), V74 (≠ C69), A75 (≠ T70), P76 (= P71), T77 (= T72), F79 (≠ M74), H80 (= H75), M83 (≠ Q78), E97 (= E92), K98 (≠ I93), M127 (≠ T121), F169 (≠ H169), H185 (= H177)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
26% identity, 40% coverage: 4:129/315 of query aligns to 6:136/340 of 1evjA
- active site: K100 (≠ I93)
- binding nicotinamide-adenine-dinucleotide: G9 (= G7), L10 (≠ A8), G11 (= G9), K12 (≠ A10), Y13 (≠ F11), D35 (≠ G32), L77 (≠ T70), P78 (= P71), N79 (≠ T72), H82 (= H75), E99 (= E92), K100 (≠ I93), R128 (≠ T121)
Sites not aligning to the query:
Query Sequence
>Ga0059261_0530 FitnessBrowser__Korea:Ga0059261_0530
MKIALAGAGAFGEKHLDGLRNIDGVEVISVVGRRLEPTQKVADKYGIPHATTELVEALEQ
PGLDAVILCTPTQMHAAQAIQCMDAGKHVQVEIPLCDSLADGEAVLAKAQETGLTCMVGH
TRRFNPSHQYLHRRIMAGELAVQQMDVQTYFFRRKNMNAKGEARSWTDHLLWHHAAHTVD
LFAYQAGPIVAANAIEGPHHPELGIAMDMSLQLKAESGAICTLSLSFNNDGPLGTFFRYI
CDNGTWIARYDDLVTGKEEPVDLTGVTVTSNGIELQDREFIAAIREGREPNASVAQVLPC
YRVLDALEKQLEAAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory