SitesBLAST
Comparing Ga0059261_0546 FitnessBrowser__Korea:Ga0059261_0546 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
7w2jD Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
26% identity, 98% coverage: 8:556/560 of query aligns to 4:537/537 of 7w2jD
- binding fe3-s4 cluster: R200 (≠ T213), C211 (= C224), G213 (≠ M226), N214 (≠ R227), N215 (= N228), C217 (= C230), C221 (= C234), I223 (≠ F236), A225 (= A238), S338 (≠ Y363)
- binding flavin-adenine dinucleotide: G9 (= G13), G11 (= G15), D32 (= D36), A33 (vs. gap), Y59 (≠ V57), K97 (≠ P109), G101 (= G114), T102 (≠ K115), T103 (≠ S116), H105 (≠ I118), W106 (= W119), S109 (≠ W122), V249 (= V264), A284 (= A301), N285 (≠ S302), E288 (≠ A305), K291 (≠ Q308), L292 (≠ I309), N472 (≠ D489), N516 (= N535), S517 (≠ P536), T518 (≠ S537)
- binding heme c: P209 (≠ T222), I223 (≠ F236)
8jejA Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
26% identity, 98% coverage: 8:556/560 of query aligns to 7:540/540 of 8jejA
- binding fe3-s4 cluster: R203 (≠ T213), C214 (= C224), C215 (≠ Q225), G216 (≠ M226), N217 (≠ R227), N218 (= N228), N219 (≠ Q229), C220 (= C230), C224 (= C234), I226 (≠ F236), M229 (≠ Y239), S341 (≠ Y363)
- binding flavin-adenine dinucleotide: I11 (= I12), G12 (= G13), G14 (= G15), I15 (≠ V16), C16 (≠ S17), D35 (= D36), A36 (vs. gap), G97 (≠ W106), K100 (≠ P109), G101 (= G110), G104 (= G114), T105 (≠ K115), T106 (≠ S116), H108 (≠ I118), W109 (= W119), A110 (≠ G120), S112 (≠ W122), M221 (≠ G231), A250 (= A262), V252 (= V264), A287 (= A301), N288 (≠ S302), E291 (≠ A305), N475 (≠ D489), H476 (= H492), N519 (= N535), T521 (≠ S537), M524 (≠ F540)
8grjB Crystal structure of gamma-alpha subunit complex from burkholderia cepacia fad glucose dehydrogenase in complex with gluconolactone
26% identity, 78% coverage: 111:549/560 of query aligns to 90:525/531 of 8grjB
- binding fe3-s4 cluster: C204 (= C224), C205 (≠ Q225), G206 (≠ M226), N207 (≠ R227), N209 (≠ Q229), C210 (= C230), C214 (= C234), P331 (vs. gap)
- binding flavin-adenine dinucleotide: T94 (≠ K115), H97 (≠ I118), W98 (= W119), A99 (≠ G120), S101 (≠ W122), M211 (≠ G231), V242 (= V264), A277 (= A301), N278 (≠ S302), E281 (≠ A305), I285 (= I309), N467 (≠ D489), N511 (= N535), T513 (≠ S537)
- binding D-glucono-1,5-lactone: M211 (≠ G231), E333 (vs. gap), H355 (≠ Y363), N466 (≠ G488), N467 (≠ D489), H468 (= H492), N511 (= N535)
Sites not aligning to the query:
4mihA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant h158a mutant (see paper)
23% identity, 53% coverage: 254:552/560 of query aligns to 260:572/576 of 4mihA
- binding flavin-adenine dinucleotide: C270 (≠ V264), C310 (≠ A301), A314 (= A305), N555 (= N535), P556 (= P536), T557 (≠ S537)
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: Q413 (≠ G387), D417 (= D391), Y421 (≠ F398), A510 (= A490), H512 (= H492), N555 (= N535)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 22, 23, 24, 43, 44, 136, 137, 138, 141, 142, 146, 147, 149
4migA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type (see paper)
23% identity, 53% coverage: 254:552/560 of query aligns to 252:566/570 of 4migA
- binding dihydroflavine-adenine dinucleotide: C262 (≠ V264), C302 (≠ A301), A306 (= A305), L505 (≠ I491), N549 (= N535), T551 (≠ S537)
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: Q407 (≠ G387), D411 (= D391), Y415 (≠ F398), A504 (= A490), H506 (= H492), N549 (= N535)
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 11, 12, 31, 32, 128, 129, 130, 133, 134, 137, 138, 139, 141
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 139
4mifB Pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source (see paper)
23% identity, 53% coverage: 254:552/560 of query aligns to 261:577/581 of 4mifB
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 11, 12, 31, 32, 138, 142, 143, 146, 147, 148, 149, 150
7qvaA Crystal structure of a bacterial pyranose 2-oxidase in complex with mangiferin (see paper)
29% identity, 24% coverage: 426:558/560 of query aligns to 323:455/457 of 7qvaA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 36, 37, 38, 97, 102, 103, 106, 107, 108, 110, 206, 207, 241, 242, 243, 246
- binding Mangiferin: 51, 73, 108, 299
7qfdA Crystal structure of a bacterial pyranose 2-oxidase complex with d- glucose (see paper)
29% identity, 24% coverage: 426:558/560 of query aligns to 324:456/458 of 7qfdA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 14, 15, 16, 36, 37, 38, 101, 106, 107, 111, 112, 114, 210, 211, 246, 250
- binding alpha-D-glucopyranose: 77, 112
7qf8A Crystal structure of a bacterial pyranose 2-oxidase from pseudoarthrobacter siccitolerans (see paper)
29% identity, 24% coverage: 426:558/560 of query aligns to 358:490/494 of 7qf8A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 37, 38, 114, 119, 120, 124, 125, 127, 227, 261, 262, 263, 266, 331
Q6UG02 Pyranose 2-oxidase; P2Ox; POD; POx; PROD; Pyranose oxidase; FAD-oxidoreductase; Glucose 2-oxidase; Pyranose:oxygen 2-oxidoreductase; EC 1.1.3.10 from Phlebiopsis gigantea (White-rot fungus) (Peniophora gigantea) (see paper)
24% identity, 32% coverage: 378:558/560 of query aligns to 440:614/622 of Q6UG02
- E540 (≠ V486) mutation to K: In P2OxB1; increases thermostability up to 70 degrees Celsius and enhances pH stability in alkaline solution. Increases the catalytic efficiency 3.1-fold for D-xylose and 7.3-fold for L-sorbose, mainly by lowering the Km values for these two substrates to 6.6 mM and 5.4 mM, respectively. In P2OxB2H; increases the catalytic efficiency 5.3-fold for D-glucose, 2-fold for methyl-beta-D-glucoside, 59.9-fold for D-xylose, 69-fold for L-sorbose and 4.8-fold for D-galactose; when associated with K-312.
Sites not aligning to the query:
- 167 H→C: Decreases activity by 90%.
- 312 K→E: In P2OxB2H; increases the catalytic efficiency 5.3-fold for D-glucose, 2-fold for methyl-beta-D-glucoside, 59.9-fold for D-xylose, 69-fold for L-sorbose and 4.8-fold for D-galactose; when associated with K-540.
Query Sequence
>Ga0059261_0546 FitnessBrowser__Korea:Ga0059261_0546
MASTNRFDAIVIGSGVSGGFAAKELTEKGLRVLMLDRGVMVEHGEDYTYDGKPAYEVPAR
NIMPKPLIESDYFIAKNGYVAPSNRRFYNDDRLNPYAHDEGSKFFWIRPGAVGGKSLIWG
RWSFRWSADDFEANKREGIDGDWPIRYDDIAPWYSKVENYIGVSGSRENLPQLPDSEFQP
PMPMNIAEKWVKQRLETQFPGRKLINARLSNLTEDKPEQNRTKCQMRNQCGNGCSFGAYF
STQAVTLPAARATGRLTLRSDAVVTNLEYDPVRKRVTGVRFVDARTRQAEVVNADLVFLC
ASAMASTQILMNSRAAGSGRSHFDSSGTLGKYVMDHIFRVGIEGEIPGMSEYIEYGRRPG
GIYIPRFRNIGADENLGFKRGYGYQGGAHRDVAPPVGFGASMKHGMRKYAPWKFHISAFG
ECLPYRDNSVSLHADKVDRFGVPLMRFDVRFRENELRMMADARTQGEAMLKAAGLGSVRS
WEGEHVPGDAIHEMGGARMGADPRSSVLNSWSQAHDASNLYVTDGAQMASVSCVNPSLTF
MALTVRAADHAVRTLRSAGT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory