Comparing Ga0059261_0551 FitnessBrowser__Korea:Ga0059261_0551 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00066 Cytochrome c from Nigella damascena (Love-in-a-mist) (see paper)
42% identity, 83% coverage: 22:126/127 of query aligns to 6:111/111 of P00066
Sites not aligning to the query:
P00046 Cytochrome c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
43% identity, 76% coverage: 27:122/127 of query aligns to 8:104/109 of P00046
Sites not aligning to the query:
4gedB Crystal structure of the leishmania major peroxidase-cytochromE C complex (see paper)
49% identity, 65% coverage: 41:123/127 of query aligns to 17:100/102 of 4gedB
Sites not aligning to the query:
P00002 Cytochrome c from Macaca mulatta (Rhesus macaque) (see paper)
45% identity, 73% coverage: 30:122/127 of query aligns to 7:100/105 of P00002
Sites not aligning to the query:
P00026 Cytochrome c iso-1/iso-2 from Cyprinus carpio (Common carp) (see paper)
42% identity, 74% coverage: 30:123/127 of query aligns to 7:101/104 of P00026
Sites not aligning to the query:
4dy9A Leishmania major peroxidase is a cytochromE C peroxidase (see paper)
49% identity, 65% coverage: 41:123/127 of query aligns to 23:106/108 of 4dy9A
Sites not aligning to the query:
P99999 Cytochrome c from Homo sapiens (Human) (see 4 papers)
45% identity, 73% coverage: 30:122/127 of query aligns to 7:100/105 of P99999
Sites not aligning to the query:
P00038 Cytochrome c from Apis mellifera (Honeybee) (see paper)
45% identity, 69% coverage: 38:125/127 of query aligns to 19:107/108 of P00038
Sites not aligning to the query:
2yk3A Crithidia fasciculata cytochromE C (see paper)
48% identity, 65% coverage: 41:122/127 of query aligns to 24:106/110 of 2yk3A
Sites not aligning to the query:
P81280 Cytochrome c from Alligator mississippiensis (American alligator) (see paper)
44% identity, 74% coverage: 30:123/127 of query aligns to 7:101/105 of P81280
Sites not aligning to the query:
P00017 Cytochrome c from Aptenodytes patagonicus (King penguin)
42% identity, 77% coverage: 30:127/127 of query aligns to 7:105/105 of P00017
Sites not aligning to the query:
P00078 Cytochrome c; Cytochrome c555 from Crithidia fasciculata (see paper)
48% identity, 65% coverage: 41:122/127 of query aligns to 28:110/114 of P00078
Sites not aligning to the query:
P00022 Cytochrome c from Chelydra serpentina (Snapping turtle) (Testudo serpentina) (see paper)
43% identity, 77% coverage: 30:127/127 of query aligns to 7:105/105 of P00022
Sites not aligning to the query:
P00020 Cytochrome c from Anas platyrhynchos (Mallard) (Anas boschas)
42% identity, 77% coverage: 30:127/127 of query aligns to 7:105/105 of P00020
Sites not aligning to the query:
P00051 Cytochrome c from Cucurbita maxima (Pumpkin) (Winter squash) (see paper)
48% identity, 70% coverage: 38:126/127 of query aligns to 22:111/111 of P00051
Sites not aligning to the query:
2n3yA Nmr structure of the y48pcmf variant of human cytochromE C in its reduced state (see paper)
44% identity, 73% coverage: 30:122/127 of query aligns to 6:99/104 of 2n3yA
P00012 Cytochrome c from Mirounga leonina (Southern elephant seal) (Phoca leonina) (see paper)
44% identity, 73% coverage: 30:122/127 of query aligns to 7:100/105 of P00012
Sites not aligning to the query:
P00011 Cytochrome c from Canis lupus familiaris (Dog) (Canis familiaris) (see paper)
44% identity, 73% coverage: 30:122/127 of query aligns to 7:100/105 of P00011
Sites not aligning to the query:
P00007 Cytochrome c from Hippopotamus amphibius (Hippopotamus) (see paper)
43% identity, 74% coverage: 30:123/127 of query aligns to 7:101/105 of P00007
Sites not aligning to the query:
P00062 Cytochrome c from Sambucus nigra (European elder) (see paper)
47% identity, 70% coverage: 38:126/127 of query aligns to 22:111/111 of P00062
Sites not aligning to the query:
>Ga0059261_0551 FitnessBrowser__Korea:Ga0059261_0551
MKLVAGVATGAVALAALGAALAPSFAQTSGAPAAFAACRACHTANKGGKNGLGPNLYGII
GKPAAAVPGVSYSAALKGSKLKWDEKTLDAFLANPSKKVPGTRMPIGTPDPAKRAAIIAY
LKAESAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory