Comparing Ga0059261_0725 FitnessBrowser__Korea:Ga0059261_0725 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9SJU4 Fructose-bisphosphate aldolase 1, chloroplastic; AtFBA1; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
32% identity, 57% coverage: 7:179/301 of query aligns to 59:229/399 of Q9SJU4
Sites not aligning to the query:
Q944G9 Fructose-bisphosphate aldolase 2, chloroplastic; AtFBA2; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 54% coverage: 17:179/301 of query aligns to 69:228/398 of Q944G9
Sites not aligning to the query:
Q9ZU52 Fructose-bisphosphate aldolase 3, chloroplastic; AtFBA3; Protein PIGMENT DEFECTIVE 345; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 57% coverage: 7:179/301 of query aligns to 51:221/391 of Q9ZU52
Sites not aligning to the query:
5tlzA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor naphthalene 2,6-bisphosphate (see paper)
30% identity, 56% coverage: 10:179/301 of query aligns to 20:187/346 of 5tlzA
Sites not aligning to the query:
5tlhA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor 2-naphthol 6-bisphosphonate (see paper)
30% identity, 56% coverage: 10:179/301 of query aligns to 23:190/350 of 5tlhA
Sites not aligning to the query:
5tlwA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor 1-phosphate-benzene 4-bisphosphonate (see paper)
30% identity, 56% coverage: 10:179/301 of query aligns to 23:190/349 of 5tlwA
Sites not aligning to the query:
5tleA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor 2-phosphate-naphthalene 6-bisphosphonate (see paper)
30% identity, 56% coverage: 10:179/301 of query aligns to 23:190/349 of 5tleA
Sites not aligning to the query:
3tu9A Crystal structure of rabbit muscle aldolase bound with 5-o-methyl mannitol 1,6-phosphate (see paper)
30% identity, 56% coverage: 10:179/301 of query aligns to 23:190/349 of 3tu9A
Sites not aligning to the query:
2ot1A Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with naphthol as-e phosphate, a competitive inhibitor (see paper)
30% identity, 56% coverage: 10:179/301 of query aligns to 23:190/349 of 2ot1A
Sites not aligning to the query:
2ot0A Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with a c-terminal peptide of wiskott-aldrich syndrome protein (see paper)
30% identity, 56% coverage: 10:179/301 of query aligns to 23:190/356 of 2ot0A
Sites not aligning to the query:
P00883 Fructose-bisphosphate aldolase A; Muscle-type aldolase; EC 4.1.2.13 from Oryctolagus cuniculus (Rabbit) (see 5 papers)
30% identity, 56% coverage: 10:179/301 of query aligns to 24:191/364 of P00883
Sites not aligning to the query:
P04075 Fructose-bisphosphate aldolase A; Lung cancer antigen NY-LU-1; Muscle-type aldolase; EC 4.1.2.13 from Homo sapiens (Human) (see 11 papers)
30% identity, 56% coverage: 10:179/301 of query aligns to 24:191/364 of P04075
Sites not aligning to the query:
1zalA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with partially disordered tagatose-1,6-bisphosphate, a weak competitive inhibitor (see paper)
30% identity, 56% coverage: 10:179/301 of query aligns to 23:190/363 of 1zalA
Sites not aligning to the query:
1zajA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with mannitol-1,6-bisphosphate, a competitive inhibitor (see paper)
30% identity, 56% coverage: 10:179/301 of query aligns to 23:190/363 of 1zajA
Sites not aligning to the query:
4aldA Human muscle fructose 1,6-bisphosphate aldolase complexed with fructose 1,6-bisphosphate (see paper)
30% identity, 56% coverage: 10:179/301 of query aligns to 23:190/363 of 4aldA
Sites not aligning to the query:
Q9SJQ9 Fructose-bisphosphate aldolase 6, cytosolic; AtFBA6; Cytosolic aldolase 2; cAld2; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 67% coverage: 13:213/301 of query aligns to 23:220/358 of Q9SJQ9
6rngB Dipeptide gly-pro binds to a glycolytic enzyme fructose bisphosphate aldolase
28% identity, 67% coverage: 13:213/301 of query aligns to 18:215/334 of 6rngB
Sites not aligning to the query:
2qdhA Fructose-1,6-bisphosphate aldolase from leishmania mexicana in complex with mannitol-1,6-bisphosphate, a competitive inhibitor (see paper)
30% identity, 56% coverage: 13:181/301 of query aligns to 36:202/366 of 2qdhA
Sites not aligning to the query:
2qdgA Fructose-1,6-bisphosphate schiff base intermediate in fbp aldolase from leishmania mexicana (see paper)
30% identity, 56% coverage: 13:181/301 of query aligns to 36:202/366 of 2qdgA
Sites not aligning to the query:
P07764 Fructose-bisphosphate aldolase; EC 4.1.2.13 from Drosophila melanogaster (Fruit fly) (see 2 papers)
28% identity, 56% coverage: 10:179/301 of query aligns to 24:191/361 of P07764
Sites not aligning to the query:
>Ga0059261_0725 FitnessBrowser__Korea:Ga0059261_0725
MNFTGMTAKIAEGNGFIAALDQSGGSTPKALKGYGIEEDAYSGDEEMFDLIHAMRSRIIT
SPSFNGDKVIGAILFERTMDGQVDGEPTPQALIERGVVPFIKIDKGLEAEENGVQLMKPM
PELDALLARAKGLGVFGTKERSVVNLANAQGIAAIVAQQFEVGRQVLAAGLMPILEPEVN
IKSPERAQADAILRDEILKHLDAMTGDDKVMLKLSIPAQPGLFDALVDHPRVLRVVALSG
GFKRPEACAELAKNRGMIASFSRALLEDLRHGMTDAEFDASLGAAIDEIHAASTVKVPVT
T
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory