SitesBLAST
Comparing Ga0059261_0728 FitnessBrowser__Korea:Ga0059261_0728 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P40924 Phosphoglycerate kinase; EC 2.7.2.3 from Bacillus subtilis (strain 168) (see paper)
48% identity, 98% coverage: 7:396/397 of query aligns to 4:392/394 of P40924
- S183 (≠ G183) modified: Phosphoserine
- T299 (≠ A300) modified: Phosphothreonine
4feyA An x-ray structure of a putative phosphogylcerate kinase with bound adp from francisella tularensis subsp. Tularensis schu s4
43% identity, 99% coverage: 5:396/397 of query aligns to 2:387/392 of 4feyA
- active site: R36 (= R40), K193 (= K197), G346 (= G355), G369 (= G378)
- binding adenosine-5'-diphosphate: G191 (= G195), S192 (≠ A196), K197 (= K201), G215 (= G219), G316 (= G321), V317 (≠ A322), E319 (= E324), D347 (= D356)
1phpA Structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms (see paper)
47% identity, 98% coverage: 7:396/397 of query aligns to 4:392/394 of 1phpA
- active site: R36 (= R40), K197 (= K197), G351 (= G355), G374 (= G378)
- binding adenosine-5'-diphosphate: G195 (= G195), K201 (= K201), G219 (= G219), G220 (= G220), L237 (= L237), N316 (= N317), P318 (= P319), G320 (= G321), V321 (≠ A322), E323 (= E324), G350 (= G354), D352 (= D356), S353 (≠ T357)
P18912 Phosphoglycerate kinase; EC 2.7.2.3 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
47% identity, 98% coverage: 7:396/397 of query aligns to 4:392/394 of P18912
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
44% identity, 98% coverage: 8:395/397 of query aligns to 5:394/654 of P36204
- R36 (= R40) binding
- R118 (= R118) binding
- R151 (= R151) binding
1vpeA Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima (see paper)
43% identity, 98% coverage: 8:396/397 of query aligns to 4:394/398 of 1vpeA
- active site: R35 (= R40), K196 (= K197), G353 (= G355), G376 (= G378)
- binding phosphoaminophosphonic acid-adenylate ester: G194 (= G195), A195 (= A196), K196 (= K197), K200 (= K201), G218 (= G219), A219 (≠ G220), N316 (= N317), P318 (= P319), G320 (= G321), V321 (≠ A322), E323 (= E324), G352 (= G354), G353 (= G355), D354 (= D356), S355 (≠ T357)
4ng4B Structure of phosphoglycerate kinase (cbu_1782) from coxiella burnetii (see paper)
42% identity, 98% coverage: 6:395/397 of query aligns to 2:384/389 of 4ng4B
- active site: R35 (= R40), K191 (= K197), G344 (= G355), G367 (= G378)
- binding adenosine-5'-diphosphate: G189 (= G195), K195 (= K201), G213 (= G219), I286 (= I293), N310 (= N317), G311 (= G318), P312 (= P319), V315 (≠ A322), E317 (= E324), G343 (= G354), D345 (= D356), T346 (= T357)
- binding magnesium ion: D288 (= D295), G314 (= G321), F321 (= F328), S322 (≠ D329), T325 (= T332)
1zmrA Crystal structure of the e. Coli phosphoglycerate kinase (see paper)
45% identity, 96% coverage: 14:396/397 of query aligns to 9:381/386 of 1zmrA
P0A799 Phosphoglycerate kinase; EC 2.7.2.3 from Escherichia coli (strain K12) (see 3 papers)
45% identity, 96% coverage: 14:396/397 of query aligns to 10:382/387 of P0A799
- K84 (≠ V86) modified: N6-acetyllysine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
16pkA Phosphoglycerate kinase from trypanosoma brucei bisubstrate analog (see paper)
38% identity, 96% coverage: 14:395/397 of query aligns to 9:412/415 of 16pkA
- active site: R35 (= R40), K215 (= K197), G372 (= G355), G395 (= G378)
- binding 1,1,5,5-tetrafluorophosphopentylphosphonic acid adenylate ester: G213 (= G195), A214 (= A196), K219 (= K201), A238 (≠ G220), Y241 (≠ N223), L311 (= L294), P336 (= P319), G338 (= G321), V339 (≠ A322), E341 (= E324), G393 (≠ A376), G394 (= G377), G395 (= G378)
13pkA Ternary complex of phosphoglycerate kinase from trypanosoma brucei (see paper)
38% identity, 96% coverage: 14:395/397 of query aligns to 9:412/415 of 13pkA
- active site: R35 (= R40), K215 (= K197), G372 (= G355), G395 (= G378)
- binding adenosine-5'-diphosphate: G213 (= G195), A214 (= A196), K219 (= K201), L311 (= L294), P336 (= P319), G338 (= G321), V339 (≠ A322), E341 (= E324), G371 (= G354), D373 (= D356), S374 (≠ T357)
P07378 Phosphoglycerate kinase, glycosomal; Phosphoglycerate kinase C; EC 2.7.2.3 from Trypanosoma brucei brucei (see 2 papers)
38% identity, 96% coverage: 14:395/397 of query aligns to 13:416/440 of P07378
3zlbA Crystal structure of phosphoglycerate kinase from streptococcus pneumoniae (see paper)
37% identity, 96% coverage: 14:395/397 of query aligns to 10:395/398 of 3zlbA
- active site: R36 (= R40), K204 (= K197), G355 (= G355), G378 (= G378)
- binding phosphoaminophosphonic acid-adenylate ester: G202 (= G195), S203 (≠ A196), G226 (= G219), G227 (= G220), N320 (= N317), P322 (= P319), G324 (= G321), V325 (≠ A322), E327 (= E324), G354 (= G354), G355 (= G355), D356 (= D356), S357 (≠ T357)
Sites not aligning to the query:
6yjeA Plasmoodium vivax phosphoglycerate kinase bound to nitrofuran inhibitor from peg3350 and ammonium acetate at ph 5.5
36% identity, 98% coverage: 8:395/397 of query aligns to 7:413/416 of 6yjeA
- active site: R39 (= R40), K215 (= K197), G373 (= G355), G396 (= G378)
- binding (2~{S})-2-(5-nitrofuran-2-yl)-2,3,5,6,7,8-hexahydro-1~{H}-[1]benzothiolo[2,3-d]pyrimidin-4-one: G237 (= G219), G238 (= G220), Y241 (≠ N223), L256 (= L237), F291 (= F272), M311 (= M292), G312 (≠ I293), L313 (= L294), G340 (= G321), V341 (≠ A322)
2wzcA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and aluminium tetrafluoride (see paper)
39% identity, 98% coverage: 8:395/397 of query aligns to 6:402/405 of 2wzcA
- active site: R37 (= R40), K204 (= K197), G362 (= G355), G385 (= G378)
- binding adenosine-5'-diphosphate: G202 (= G195), A203 (= A196), K204 (= K197), K208 (= K201), G226 (= G219), G227 (= G220), N325 (= N317), P327 (= P319), G329 (= G321), V330 (≠ A322), E332 (= E324), G361 (= G354), D363 (= D356), T364 (= T357)
- binding tetrafluoroaluminate ion: R37 (= R40), K204 (= K197), K208 (= K201), G361 (= G354), G362 (= G355), G384 (= G377)
2wzbA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and magnesium trifluoride (see paper)
39% identity, 98% coverage: 8:395/397 of query aligns to 6:402/405 of 2wzbA
- active site: R37 (= R40), K204 (= K197), G362 (= G355), G385 (= G378)
- binding adenosine-5'-diphosphate: G202 (= G195), A203 (= A196), K204 (= K197), K208 (= K201), G226 (= G219), G227 (= G220), N325 (= N317), P327 (= P319), G329 (= G321), V330 (≠ A322), E332 (= E324), G361 (= G354), D363 (= D356), T364 (= T357)
- binding trifluoromagnesate: K204 (= K197), K208 (= K201), G361 (= G354), G384 (= G377), G385 (= G378)
P09041 Phosphoglycerate kinase 2; Phosphoglycerate kinase, testis specific; EC 2.7.2.3 from Mus musculus (Mouse) (see paper)
38% identity, 99% coverage: 1:395/397 of query aligns to 1:414/417 of P09041
4axxA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp 3-phosphoglycerate and beryllium trifluoride
39% identity, 98% coverage: 8:395/397 of query aligns to 6:404/407 of 4axxA
- active site: R37 (= R40), K206 (= K197), G364 (= G355), G387 (= G378)
- binding adenosine-5'-diphosphate: G204 (= G195), A205 (= A196), K210 (= K201), G228 (= G219), G229 (= G220), N327 (= N317), P329 (= P319), G331 (= G321), V332 (≠ A322), E334 (= E324), G363 (= G354), G364 (= G355), D365 (= D356), T366 (= T357)
- binding beryllium trifluoride ion: K206 (= K197), K210 (= K201), G363 (= G354)
2x15A The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp and 1,3- bisphosphoglycerate
39% identity, 98% coverage: 8:395/397 of query aligns to 6:405/408 of 2x15A
- active site: R37 (= R40), K207 (= K197), G365 (= G355), G388 (= G378)
- binding adenosine-5'-diphosphate: G205 (= G195), A206 (= A196), K207 (= K197), K211 (= K201), G229 (= G219), G230 (= G220), N328 (= N317), P330 (= P319), G332 (= G321), V333 (≠ A322), E335 (= E324), G364 (= G354), G365 (= G355), D366 (= D356), T367 (= T357)
- binding adenosine-5'-triphosphate: G205 (= G195), A206 (= A196), K207 (= K197), K211 (= K201), G229 (= G219), G230 (= G220), N328 (= N317), G332 (= G321), V333 (≠ A322), E335 (= E324), G364 (= G354), G365 (= G355), D366 (= D356), T367 (= T357), G387 (= G377), G388 (= G378)
- binding 1,3-bisphosphoglyceric acid: D22 (= D25), N24 (= N27), R37 (= R40), H61 (= H63), R64 (= R66), R121 (= R118), R162 (= R151), K207 (= K197), K211 (= K201), G364 (= G354), G387 (= G377), G388 (= G378)
2wzdA The catalytically active fully closed conformation of human phosphoglycerate kinase k219a mutant in complex with adp, 3pg and aluminium trifluoride (see paper)
39% identity, 98% coverage: 8:395/397 of query aligns to 6:402/405 of 2wzdA
- active site: R37 (= R40), K204 (= K197), G362 (= G355), G385 (= G378)
- binding adenosine-5'-diphosphate: G202 (= G195), A203 (= A196), K204 (= K197), G226 (= G219), G227 (= G220), N325 (= N317), P327 (= P319), G329 (= G321), V330 (≠ A322), E332 (= E324), G361 (= G354), D363 (= D356), T364 (= T357)
- binding aluminum fluoride: R37 (= R40), K204 (= K197), G361 (= G354), G362 (= G355), G384 (= G377)
Query Sequence
>Ga0059261_0728 FitnessBrowser__Korea:Ga0059261_0728
MSERAFKTLDDMGDVTGKRVLVREDLNVPMADGHVTDDTRLRAAVPTVSELADKGAIVLV
LAHFGRPKTPSPELSTAQLVRPFSQVLGRPVRYIDWEGDIESTATLQPGDIAVLENTRFF
GGEEKNDPKVIDRFAALGDFYVNDAFSAAHRAHASTEGLAHRLPAFAGRQMEAELDALDK
ALGNPEHPVAAVVGGAKVSTKLDVLKHLVGQVDHLIIGGGMANTFLAARGVNVGKSLCEH
DLTGTAEEIFDAAEKANCTIHLPYDVVVSKEFAANPPSLRTCNVHEVAEDEMILDVGPAA
SEALADVLKNCRTLVWNGPLGAFETKPFDTATMALAHTVAALTKEGSLVSVAGGGDTVAA
LNQAGVSSEMTFVSTAGGAFLEWMEGKALPGVAALHG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory