Comparing Ga0059261_0769 FitnessBrowser__Korea:Ga0059261_0769 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ac0A Crystal structure of beta-glucosidase from kluyveromyces marxianus in complex with glucose (see paper)
34% identity, 96% coverage: 37:837/838 of query aligns to 5:833/841 of 3ac0A
4i3gB Crystal structure of desr, a beta-glucosidase from streptomyces venezuelae in complex with d-glucose. (see paper)
37% identity, 96% coverage: 35:836/838 of query aligns to 3:779/780 of 4i3gB
D5EY15 Xylan 1,4-beta-xylosidase; 1,4-beta-D-xylan xylohydrolase; Alpha-L-arabinofuranosidase; Arabinosidase; Beta-D-xylosidase; Exo-1,4-beta-xylosidase; EC 3.2.1.37; EC 3.2.1.55 from Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) (see paper)
31% identity, 98% coverage: 7:827/838 of query aligns to 5:851/861 of D5EY15
5wabA Crystal structure of bifidobacterium adolescentis gh3 beta-glucosidase (see paper)
45% identity, 43% coverage: 44:405/838 of query aligns to 8:360/674 of 5wabA
2x41A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with glucose (see paper)
38% identity, 43% coverage: 36:392/838 of query aligns to 2:385/715 of 2x41A
Sites not aligning to the query:
2x42A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with alpha-d-glucose (see paper)
38% identity, 43% coverage: 36:392/838 of query aligns to 2:385/715 of 2x42A
Sites not aligning to the query:
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
33% identity, 46% coverage: 25:407/838 of query aligns to 3:449/753 of 7zgzX
Sites not aligning to the query:
7zdyW Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside
35% identity, 41% coverage: 25:370/838 of query aligns to 3:409/763 of 7zdyW
Sites not aligning to the query:
7zb3A Crystal structure of beta-xylosidase from thermotoga maritima in complex with xylohexaose hydrolysed to xylobiose
35% identity, 41% coverage: 25:370/838 of query aligns to 3:409/765 of 7zb3A
Sites not aligning to the query:
8c7fA Crystal structure of beta-xylosidase mutant (d281n, e517q) from thermotoga maritima in complex with xylopentaose
34% identity, 41% coverage: 25:370/838 of query aligns to 3:409/772 of 8c7fA
Sites not aligning to the query:
4iihA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with thiocellobiose (see paper)
32% identity, 41% coverage: 36:378/838 of query aligns to 25:416/833 of 4iihA
Sites not aligning to the query:
4iicA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with isofagomine (see paper)
32% identity, 41% coverage: 36:378/838 of query aligns to 25:416/833 of 4iicA
Sites not aligning to the query:
4iifA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with castanospermine (see paper)
32% identity, 41% coverage: 36:378/838 of query aligns to 25:416/833 of 4iifA
Sites not aligning to the query:
4iigA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with d-glucose (see paper)
32% identity, 41% coverage: 36:378/838 of query aligns to 25:416/834 of 4iigA
Sites not aligning to the query:
4iieA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with calystegine b(2) (see paper)
32% identity, 41% coverage: 36:378/838 of query aligns to 25:416/834 of 4iieA
Sites not aligning to the query:
4iidA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with 1-deoxynojirimycin (see paper)
32% identity, 41% coverage: 36:378/838 of query aligns to 25:416/834 of 4iidA
Sites not aligning to the query:
4iibA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus (see paper)
32% identity, 41% coverage: 36:378/838 of query aligns to 25:416/834 of 4iibA
Sites not aligning to the query:
5wvpA Expression, characterization and crystal structure of a novel beta- glucosidase from paenibacillus barengoltzii
37% identity, 32% coverage: 68:331/838 of query aligns to 535:812/924 of 5wvpA
Sites not aligning to the query:
6jxgA Crystasl structure of beta-glucosidase d2-bgl from chaetomella raphigera (see paper)
37% identity, 36% coverage: 64:366/838 of query aligns to 46:359/713 of 6jxgA
Sites not aligning to the query:
5ju6A Structural and functional studies of glycoside hydrolase family 3 beta-glucosidase cel3a from the moderately thermophilic fungus rasamsonia emersonii (see paper)
33% identity, 39% coverage: 36:366/838 of query aligns to 26:401/835 of 5ju6A
Sites not aligning to the query:
>Ga0059261_0769 FitnessBrowser__Korea:Ga0059261_0769
MRSGAAIALTLAMAAPAGSQEAAPVYRDAKAPIEARVADLMARLTLDEKILLLAGESSMA
LNPIPRLGIPAVKMTDGPTGVRSPDGKPATVFPVGVALAASWNPDLAATVGAAVARETKA
HGADVLLAPTVNIVRTPRWGRNFETYSEDPWLSGRMGLGYVRGVQGEGIGVSLKHFAVNN
QESYRFVVDSIVDQRTLHEIYLPAFEMVVREADPWSVMASYNKINGTYAAENRWLLTDLL
KKEWGYRGFVVSDWGATHTTAEAVNAGMDLEMPGPPKHFGDKLKAAVAEGKVSTAQIDDN
ARRMVRLIVRSGVIERGASRPEAATPLRQSAIARKAAEEAMVLLKNNGVLPFDRSIRSLA
VIGPNADVVRMQGGGSSNVVPFETQTPLDALRAALPGVRITYEKGVDNEETPPAADAKLF
SPDGKRGETGLTGSYFMTADASGEPVKTERVTRFVRWISGNVAGPKATGYAAIRWDGMFW
PRTGGVHEFSVRGTGTPRVTLDGKVILEKASKVVPDNRDVLGFPVPRRTVQVTLEAGRGY
PIRIDYANGGTPYENLSFGVREPQPSFDAAVAAAKGADAAIVIVGSSSTTEGEGYDRANI
DLPGEQNRLVEAIAAANPKTAVVVNAGAAMTMPWHEKAPAIVSMWLPGEGGAAALADVLT
GKVNPSGKLPVTFPQRSGDDLADLKTSKSAYSEGLLVGYRGYQARGVKPLFPFGHGLSYT
SFAYSPLNVPARASGAKPVTVKLTVRNTGKRTGQEVVQLYVEPVEPMAGDPPRTLRAFQK
VAIPAGGKREVTLTLDPRAFSFYDVKAGGWRVRPGAYRVLAGSSSEDIRQAGEIRVDP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory