Comparing Ga0059261_0797 FitnessBrowser__Korea:Ga0059261_0797 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
40% identity, 99% coverage: 5:373/373 of query aligns to 6:376/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
40% identity, 98% coverage: 5:371/373 of query aligns to 6:374/375 of 4pqaA
7lgpB Dape enzyme from shigella flexneri
39% identity, 99% coverage: 4:373/373 of query aligns to 7:377/377 of 7lgpB
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
41% identity, 96% coverage: 15:373/373 of query aligns to 16:376/377 of 7t1qA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
39% identity, 98% coverage: 4:368/373 of query aligns to 5:371/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
39% identity, 98% coverage: 4:368/373 of query aligns to 9:375/380 of 5vo3A
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
40% identity, 47% coverage: 4:178/373 of query aligns to 5:180/265 of 4op4B
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
42% identity, 47% coverage: 4:178/373 of query aligns to 7:182/258 of 4h2kA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 60% coverage: 53:275/373 of query aligns to 55:280/383 of 7uoiA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
26% identity, 84% coverage: 48:361/373 of query aligns to 80:410/426 of 3pfoA
7rsfA Acetylornithine deacetylase from escherichia coli
30% identity, 57% coverage: 1:213/373 of query aligns to 2:213/380 of 7rsfA
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
28% identity, 49% coverage: 3:183/373 of query aligns to 2:161/341 of 5xoyA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
27% identity, 51% coverage: 68:257/373 of query aligns to 128:377/507 of Q96KN2
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
28% identity, 62% coverage: 26:257/373 of query aligns to 68:289/415 of P06621
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
28% identity, 62% coverage: 26:257/373 of query aligns to 43:264/389 of 1cg2A
Sites not aligning to the query:
3ki9A Crystal structure of staphylococcus aureus metallopeptidase (sapep/dape) in the mn2+ bound form (see paper)
35% identity, 24% coverage: 72:161/373 of query aligns to 85:183/467 of 3ki9A
Sites not aligning to the query:
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
32% identity, 48% coverage: 15:194/373 of query aligns to 24:183/366 of Q8P8J5
3dljA Crystal structure of human carnosine dipeptidase 1
27% identity, 51% coverage: 68:257/373 of query aligns to 97:344/471 of 3dljA
Sites not aligning to the query:
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
32% identity, 47% coverage: 15:191/373 of query aligns to 25:181/360 of 2f7vA
P45494 Beta-Ala-Xaa dipeptidase; Beta-Ala-His dipeptidase; Peptidase V; EC 3.4.13.- from Lactobacillus delbrueckii subsp. lactis (see paper)
36% identity, 17% coverage: 71:133/373 of query aligns to 86:154/470 of P45494
Sites not aligning to the query:
>Ga0059261_0797 FitnessBrowser__Korea:Ga0059261_0797
LPDVVELTKALIAAPSITPAHGSVFDVLEAALRPLGFTVDRFVAGEAPDGPVENLLAVRN
AGPGPHFAFAGHLDVVPPGEGWTSGAFEPEVRGDLLYGRGAVDMKGSIAAFAAAVAALPA
SGTLSLIITGDEEGPATYGTLALMDRMAAAGLTPDMCLVGEPTSAHRLGDTIKIGRRGST
VIDIEVPGRQGHVAYPHLADNPIPRLVRALAEIDAIELDEGTDWFQPSNIETIDLTVGNP
ATNVIPGKASARLSIRFNDQHRGQDLIERIERIVHAHAPAGIVRGRVYGEAFLTEPGTLS
TLISDAIEVETGIRPELSTSGGTSDARFLSRICPVVEFGLLNATMHKLDEAVALDDLHKL
TAIYETLLRRVYA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory