SitesBLAST
Comparing Ga0059261_0837 FitnessBrowser__Korea:Ga0059261_0837 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
52% identity, 99% coverage: 10:676/676 of query aligns to 7:692/692 of 6iunB
- active site: A60 (= A63), F65 (= F68), E73 (= E74), H77 (≠ P78), G101 (= G102), E104 (= E105), E124 (= E125), G132 (= G133), K248 (≠ Q248), S407 (= S407), H428 (= H428), E440 (= E440), N478 (= N478)
- binding nicotinamide-adenine-dinucleotide: G300 (= G300), T301 (= T301), M302 (= M302), E321 (= E321), T322 (≠ M322), Y365 (≠ L365), A377 (= A377), V378 (= V378), E380 (= E380), V384 (= V384), V388 (≠ I388), N405 (= N405), S407 (= S407)
Q08426 Peroxisomal bifunctional enzyme; PBE; PBFE; L-bifunctional protein; LBP; Multifunctional enzyme 1; MFE1; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 from Homo sapiens (Human) (see 5 papers)
40% identity, 96% coverage: 7:656/676 of query aligns to 5:682/723 of Q08426
- V40 (≠ A42) to G: in dbSNP:rs1062551
- I41 (≠ G43) to R: in dbSNP:rs1062552
- T75 (≠ S76) to I: in dbSNP:rs1062553
- K165 (≠ D166) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-171; Q-346 and Q-584.
- K171 (≠ R172) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-346 and Q-584.
- A274 (= A272) to T: in dbSNP:rs2302819
- A325 (≠ I319) to G: in dbSNP:rs1062555
- K346 (≠ A340) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-584.
- K584 (≠ D560) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-346.
- K598 (≠ E572) to T: in dbSNP:rs1042437
- T606 (≠ K580) to P: in dbSNP:rs1042438
Sites not aligning to the query:
- 3 E → K: in FRTS3; the mutant is mistargeted to mitochondria; results in impaired mitochondrial oxidative phosphorylation and defects in the transport of fluids across the epithelium of renal proximal tubular cells; dbSNP:rs398124646
6zicAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with 3s-hydroxybutanoyl-coa and nadh'
41% identity, 95% coverage: 12:656/676 of query aligns to 15:684/723 of 6zicAAA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), G136 (= G133), K254 (≠ Q248), S413 (= S407), H434 (= H428), E446 (= E440), N484 (= N478)
- binding 3-hydroxybutanoyl-coenzyme a: P25 (= P22), V26 (= V23), A28 (= A25), A66 (= A63), D67 (= D64), I68 (= I65), G104 (= G101), G105 (= G102), E108 (= E105), E128 (= E125), Y161 (≠ P158)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G308 (= G298), G310 (= G300), T311 (= T301), M312 (= M302), E331 (= E321), S332 (≠ M322), Q336 (≠ A326), A383 (= A377), V384 (= V378), F385 (≠ Y379), E386 (= E380), L390 (≠ V384), K391 (= K385), N411 (= N405), S413 (= S407), H434 (= H428)
6zibAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nadh'
41% identity, 95% coverage: 12:656/676 of query aligns to 15:684/723 of 6zibAAA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), G136 (= G133), K254 (≠ Q248), S413 (= S407), H434 (= H428), E446 (= E440), N484 (= N478)
- binding acetoacetyl-coenzyme a: P25 (= P22), V26 (= V23), A64 (= A61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), G104 (= G101), G105 (= G102), E128 (= E125), Y161 (≠ P158)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G310 (= G300), T311 (= T301), M312 (= M302), E331 (= E321), S332 (≠ M322), Q336 (≠ A326), A383 (= A377), V384 (= V378), F385 (≠ Y379), E386 (= E380), N411 (= N405), H434 (= H428)
3zwaA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa (see paper)
40% identity, 95% coverage: 12:656/676 of query aligns to 16:687/727 of 3zwaA
- active site: A67 (= A63), F72 (= F68), G82 (≠ P78), G106 (= G102), E109 (= E105), P128 (= P124), E129 (= E125), P136 (= P132), G137 (= G133), K255 (≠ Q248), S416 (= S407), H437 (= H428), E449 (= E440), N487 (= N478)
- binding (S)-3-Hydroxyhexanoyl-CoA: V27 (= V23), A65 (= A61), G66 (= G62), A67 (= A63), D68 (= D64), I69 (= I65), L104 (= L100), E109 (= E105), R124 (≠ K120), E129 (= E125), L132 (= L128), G137 (= G133), Y162 (≠ P158)
5omoA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with with 3s-hydroxy-decanoyl-coa and 3-keto- decanoyl-coa
40% identity, 95% coverage: 12:656/676 of query aligns to 15:686/725 of 5omoA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), P135 (= P132), G136 (= G133), K254 (≠ Q248), S415 (= S407), H436 (= H428), E448 (= E440), N486 (= N478)
- binding (s)-3-hydroxydecanoyl-coa: P25 (= P22), V26 (= V23), A28 (= A25), P31 (≠ A28), A64 (= A61), A66 (= A63), D67 (= D64), I68 (= I65), L103 (= L100), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), Y161 (≠ P158), F260 (= F254), K280 (≠ R274)
- binding 3-keto-decanoyl-coa: S415 (= S407), N486 (= N478), K519 (≠ P511), M520 (= M512), V525 (≠ M517), Y658 (= Y628)
5mgbA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and NAD (see paper)
40% identity, 95% coverage: 12:656/676 of query aligns to 15:686/725 of 5mgbA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), P135 (= P132), G136 (= G133), K254 (≠ Q248), S415 (= S407), H436 (= H428), E448 (= E440), N486 (= N478)
- binding acetoacetyl-coenzyme a: P25 (= P22), V26 (= V23), A64 (= A61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), G105 (= G102), E128 (= E125), Y161 (≠ P158)
- binding nicotinamide-adenine-dinucleotide: L307 (≠ I297), G308 (= G298), G310 (= G300), T311 (= T301), M312 (= M302), E331 (= E321), S332 (≠ M322), Q336 (≠ A326), V386 (= V378), F387 (≠ Y379), E388 (= E380), N413 (= N405), S415 (= S407), H436 (= H428)
3zwcA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa (see paper)
40% identity, 95% coverage: 12:656/676 of query aligns to 15:686/725 of 3zwcA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), P135 (= P132), G136 (= G133), K254 (≠ Q248), S415 (= S407), H436 (= H428), E448 (= E440), N486 (= N478)
- binding (s)-3-hydroxydecanoyl-coa: V26 (= V23), A64 (= A61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), G77 (≠ E74), L78 (≠ P75), L80 (= L77), V101 (≠ T98), G104 (= G101), G105 (= G102), E108 (= E105), E128 (= E125), F260 (= F254)
- binding nicotinamide-adenine-dinucleotide: G308 (= G298), G310 (= G300), T311 (= T301), M312 (= M302), E331 (= E321), Q336 (≠ A326), A385 (= A377), V386 (= V378), F387 (≠ Y379), E388 (= E380), K393 (= K385), N413 (= N405), S415 (= S407), H436 (= H428)
2x58A The crystal structure of mfe1 liganded with coa (see paper)
40% identity, 95% coverage: 12:656/676 of query aligns to 15:686/725 of 2x58A
- active site: A66 (= A63), F71 (= F68), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), P135 (= P132), G136 (= G133), K254 (≠ Q248), S415 (= S407), H436 (= H428), E448 (= E440), N486 (= N478)
- binding adenosine-5'-diphosphate: G310 (= G300), T311 (= T301), M312 (= M302), E331 (= E321), S332 (≠ M322), Q336 (≠ A326), V386 (= V378), L392 (≠ V384)
- binding coenzyme a: V26 (= V23), A28 (= A25), A64 (= A61), A66 (= A63), D67 (= D64), I68 (= I65), E128 (= E125)
3zw9A Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2- methylbutanoyl-coa (see paper)
40% identity, 95% coverage: 12:656/676 of query aligns to 13:684/723 of 3zw9A
- active site: A64 (= A63), F69 (= F68), G79 (≠ P78), G103 (= G102), E106 (= E105), P125 (= P124), E126 (= E125), P133 (= P132), G134 (= G133), K252 (≠ Q248), S413 (= S407), H434 (= H428), E446 (= E440), N484 (= N478)
- binding nicotinamide-adenine-dinucleotide: L305 (≠ I297), G306 (= G298), G308 (= G300), T309 (= T301), M310 (= M302), E329 (= E321), Q334 (≠ A326), A383 (= A377), V384 (= V378), F385 (≠ Y379), E386 (= E380), N411 (= N405), S413 (= S407), H434 (= H428)
- binding (2s,3s)-3-hydroxy-2-methylbutanoyl-coa: V24 (= V23), A62 (= A61), G63 (= G62), A64 (= A63), I66 (= I65), G102 (= G101), G103 (= G102), E106 (= E105), E126 (= E125), P133 (= P132), Y159 (≠ P158)
3zwbA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa (see paper)
40% identity, 95% coverage: 12:656/676 of query aligns to 15:686/725 of 3zwbA
- active site: A66 (= A63), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), A128 (≠ E125), P135 (= P132), G136 (= G133), S415 (= S407), H436 (= H428), E448 (= E440), N486 (= N478)
- binding (2E)-Hexenoyl-CoA: P25 (= P22), V26 (= V23), A28 (= A25), A64 (= A61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), V101 (≠ T98), L103 (= L100), G105 (= G102), E108 (= E105), G136 (= G133), Y161 (≠ P158), K280 (≠ R274)
6z5oAAA Peroxisomal bifunctional enzyme (see paper)
40% identity, 95% coverage: 12:656/676 of query aligns to 16:680/716 of 6z5oAAA
- active site: A67 (= A63), F72 (= F68), G82 (≠ P78), G106 (= G102), E109 (= E105), P128 (= P124), E129 (= E125), G137 (= G133), K255 (≠ Q248), S409 (= S407), H430 (= H428), E442 (= E440), N480 (= N478)
- binding coenzyme a: P26 (= P22), V27 (= V23), A65 (= A61), D68 (= D64), I69 (= I65), P128 (= P124), Y162 (≠ P158), F277 (= F270), K281 (≠ R274)
- binding nicotinamide-adenine-dinucleotide: G309 (= G298), G311 (= G300), T312 (= T301), M313 (= M302), E332 (= E321), S333 (≠ M322), Q337 (≠ A326), A379 (= A377), V380 (= V378), F381 (≠ Y379), E382 (= E380), K387 (= K385), N407 (= N405), S409 (= S407), H430 (= H428)
- binding nicotinamide: A67 (= A63), E109 (= E105), E129 (= E125), P136 (= P132), F261 (= F254)
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
34% identity, 96% coverage: 30:676/676 of query aligns to 40:715/715 of 1wdlA
- active site: A69 (= A63), N89 (≠ L83), N93 (≠ S87), G117 (= G102), E120 (= E105), P139 (= P124), E140 (= E125), P147 (= P132), G148 (= G133), S430 (= S407), H451 (= H428), E463 (= E440), N501 (= N478)
- binding nicotinamide-adenine-dinucleotide: A322 (= A299), I324 (≠ T301), M325 (= M302), D344 (≠ E321), I345 (≠ M322), A400 (= A377), V401 (= V378), E403 (= E380), N428 (= N405), T429 (= T406), S430 (= S407)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
34% identity, 96% coverage: 30:676/676 of query aligns to 40:715/715 of P28793
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
34% identity, 96% coverage: 30:676/676 of query aligns to 40:707/707 of 1wdmA
- active site: A69 (= A63), N89 (≠ L83), N93 (≠ S87), G117 (= G102), E120 (= E105), P139 (= P124), E140 (= E125), P147 (= P132), G148 (= G133), S430 (= S407), H451 (= H428), E463 (= E440), N501 (= N478)
- binding acetyl coenzyme *a: K142 (= K127), D297 (≠ E273), M459 (= M436), N501 (= N478), P534 (= P511), Y652 (= Y626), L658 (≠ P632)
- binding nicotinamide-adenine-dinucleotide: G321 (= G298), A322 (= A299), I324 (≠ T301), M325 (= M302), D344 (≠ E321), V401 (= V378), E403 (= E380), N428 (= N405), S430 (= S407), N454 (≠ S431)
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 96% coverage: 23:668/676 of query aligns to 28:707/729 of P21177
- G116 (= G102) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- G322 (= G300) mutation to A: 10-fold increase in KM for NADH.
- H450 (= H428) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
33% identity, 96% coverage: 23:668/676 of query aligns to 28:707/719 of 6tnmA
- active site: A68 (= A63), F73 (= F68), G116 (= G102), E119 (= E105), P138 (= P124), E139 (= E125), G147 (= G133), N271 (≠ Q248), S429 (= S407), H450 (= H428), E462 (= E440), N500 (= N478)
- binding adenosine-5'-triphosphate: D343 (≠ E321), I344 (≠ M322), V400 (= V378), V401 (≠ Y379), V406 (= V384), K584 (= K550)
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
34% identity, 96% coverage: 9:655/676 of query aligns to 9:677/707 of 6yswA
- active site: A66 (= A63), I71 (≠ F68), A84 (≠ V79), Q88 (vs. gap), G112 (= G102), E115 (= E105), P136 (= P124), E137 (= E125), G145 (= G133), D264 (≠ Q248), S422 (= S407), H443 (= H428), E455 (= E440), N493 (= N478)
- binding coenzyme a: E23 (vs. gap), M25 (≠ V23), A66 (= A63), D67 (= D64), I68 (= I65), P136 (= P124), E137 (= E125), L140 (= L128), T290 (≠ R274), K293 (≠ A277)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
31% identity, 98% coverage: 10:673/676 of query aligns to 46:759/763 of P40939
- V282 (= V210) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (= I232) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (≠ I269) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E440) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
32% identity, 92% coverage: 13:636/676 of query aligns to 13:669/711 of 7o4uA
Query Sequence
>Ga0059261_0837 FitnessBrowser__Korea:Ga0059261_0837
MTGPITTERQGDILVITSNNPPVNALGAAVRQGLDAAIKELAGDDSLKAAVIRCDGRTFF
AGADITEFGKPMQEPSLPVLVDLIEASEKPVVAAVHGTALGGGCEVALACHYRIAVPSAK
FGLPEVKLGILPGAGGTQRLPRVGGVEFALELATKGDPVSASAAKDAGLVDRLAGEDSLT
ADAIAYANEIAAARPLPRTSEKPVTVEAGVFEAFRKTNAKRFRNMDAPAEIIAVIEETAG
KPYAEGVQRERMGFMKLIMGAQSAALRHIFFAERKAAKIDDVPEDTKLRPIKRVGVIGAG
TMGGGISMNFLSAGIPVTIAEMQQEALDRGTGTIRKNYEATAAKGRMTAEQVEGAMGLLK
STLDLNDLAECDLIIEAVYENMDVKKDIFGKLDKIAKPGAILASNTSYLSIDEIASATGR
PGDVVGMHFFSPANIMKLLEVVRGAKTDKDVLATVMDLAKKIKKVAVVAGVCYGFIGNRM
LIPRQMEAMKLLHEGATPMQVDKVHVEFGMPMGPFQMSDLAGVDIGWHRDPTRIENIRDA
LAAENRWGQKTKAGFYDYDDKRNPSPSPRVAEIIEEFRTKTGTPQHEVTDEEIMERTFYT
MVNEGAKILEEGMAQRASDIDVVWIYGYGWPPYRGGPMFWADQVGLKTIVAGLEKHGFEI
SKLLRDKAESGGKFNG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory