SitesBLAST
Comparing Ga0059261_0861 FitnessBrowser__Korea:Ga0059261_0861 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
I6YCA3 Acyl-CoA dehydrogenase FadE26; ACAD; 3-oxocholest-4-en-26-oyl-CoA dehydrogenase alpha subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 85% coverage: 59:399/403 of query aligns to 52:395/400 of I6YCA3
- IGYS 127:130 (≠ QGYS 136:139) binding
- T136 (≠ S145) binding
- S162 (= S171) binding
- E247 (= E253) mutation to A: Loss of dehydrogenase activity.
- TNE 380:382 (≠ STE 384:386) binding
P96855 Acyl-CoA dehydrogenase FadE34; ACAD; 3-oxochol-4-en-24-oyl-CoA dehydrogenase; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 85% coverage: 58:399/403 of query aligns to 387:709/711 of P96855
- E581 (= E253) mutation to Q: Displays less than 1% activity with cholyl-CoA as substrate. Still binds FAD.
Sites not aligning to the query:
- 236 R→A: Displays less than 2% activity with cholyl-CoA as substrate. Cannot bind FAD.
4x28A Crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis (see paper)
32% identity, 85% coverage: 59:399/403 of query aligns to 45:382/386 of 4x28A
- active site: Y122 (= Y138), S123 (= S139), E240 (= E253), G365 (= G382), M377 (≠ K394)
- binding dihydroflavine-adenine dinucleotide: I120 (≠ Q136), Y122 (= Y138), S123 (= S139), G128 (= G144), T129 (≠ S145), W153 (= W169), S155 (= S171), F363 (vs. gap), T367 (≠ S384), E369 (= E386), V370 (≠ I387)
6wy8B Tcur3481-tcur3483 steroid acad (see paper)
36% identity, 65% coverage: 4:265/403 of query aligns to 3:253/384 of 6wy8B
Sites not aligning to the query:
6wy9A Tcur3481-tcur3483 steroid acad g363a variant (see paper)
36% identity, 65% coverage: 6:265/403 of query aligns to 1:249/380 of 6wy9A
Sites not aligning to the query:
P71858 Acyl-CoA dehydrogenase FadE29; ACAD; 3-oxo-23,24-bisnorchol-4-en-22-oyl-CoA dehydrogenase beta subunit; 3-oxo-4-pregnene-20-carboxyl-CoA dehydrogenase beta subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 53% coverage: 50:261/403 of query aligns to 39:249/387 of P71858
- E241 (= E253) mutation to Q: Unable to dehydrogenate pregnene-carboxyl-CoA ester.
3mpjB Structure of the glutaryl-coenzyme a dehydrogenase (see paper)
37% identity, 52% coverage: 57:264/403 of query aligns to 44:256/393 of 3mpjB
- active site: I128 (≠ Y138), T129 (≠ S139), T245 (≠ E253)
- binding flavin-adenine dinucleotide: F126 (≠ Q136), I128 (≠ Y138), T129 (≠ S139), G134 (= G144), S135 (= S145), W159 (= W169), I160 (≠ T170), S161 (= S171)
- binding : A164 (≠ Q174), Q165 (≠ W175), D167 (= D177), N193 (≠ D202)
Sites not aligning to the query:
C3UVB0 Glutaryl-CoA dehydrogenase; GDH(Des); EC 1.3.99.32 from Desulfococcus multivorans (see paper)
37% identity, 52% coverage: 57:264/403 of query aligns to 44:256/389 of C3UVB0
- A80 (= A91) mutation to E: Loses the FAD cofactor and dehydrogenase activity.
- R87 (≠ N97) binding
- V88 (≠ P98) mutation to S: A residual dehydrogenase activity is observed.
- N91 (≠ G101) binding
- FGIT 126:129 (≠ QGYS 136:139) binding
- S135 (= S145) binding ; binding
- WIS 159:161 (≠ WTS 169:171) binding
- S181 (≠ Q191) binding
Sites not aligning to the query:
- 271 binding
- 281:284 binding
- 340 binding
- 344 binding
- 366 V→Y: Loses the FAD cofactor but a residual dehydrogenase activity is observed.
- 367:371 binding
- 385 binding
3mpiC Structure of the glutaryl-coenzyme a dehydrogenase glutaryl-coa complex (see paper)
37% identity, 52% coverage: 57:264/403 of query aligns to 44:256/395 of 3mpiC
- active site: I128 (≠ Y138), T129 (≠ S139), T245 (≠ E253)
- binding flavin-adenine dinucleotide: I128 (≠ Y138), T129 (≠ S139), G134 (= G144), S135 (= S145), W159 (= W169), I160 (≠ T170), S161 (= S171)
- binding glutaryl-coenzyme A: R87 (≠ N97), F126 (≠ Q136), S135 (= S145), V137 (≠ L147), S181 (≠ Q191), F239 (≠ K247), R246 (= R254)
Sites not aligning to the query:
- active site: 367, 379
- binding flavin-adenine dinucleotide: 365, 366, 369, 371, 375
- binding glutaryl-coenzyme A: 315, 366, 367, 368, 376, 385, 389
8hk0B Crystal structure of fic32-33 complex from streptomyces ficellus nrrl 8067 (see paper)
32% identity, 60% coverage: 15:257/403 of query aligns to 11:247/379 of 8hk0B
Sites not aligning to the query:
2pg0A Crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
29% identity, 86% coverage: 52:396/403 of query aligns to 39:378/380 of 2pg0A
- active site: M124 (≠ Y138), T125 (≠ S139), E243 (= E253), A364 (≠ G382), R376 (≠ K394)
- binding flavin-adenine dinucleotide: I122 (≠ Q136), M124 (≠ Y138), T125 (≠ S139), G130 (= G144), S131 (= S145), F155 (≠ W169), I156 (≠ T170), T157 (≠ S171), R269 (≠ D282), F272 (vs. gap), F279 (vs. gap), Q337 (≠ E347), L338 (≠ I348), G340 (= G350), G341 (= G358), V359 (≠ A377), I362 (= I380), Y363 (= Y381), T366 (≠ S384), E368 (= E386), M369 (≠ I387)
P26440 Isovaleryl-CoA dehydrogenase, mitochondrial; IVD; Butyryl-CoA dehydrogenase; EC 1.3.8.4; EC 1.3.8.1 from Homo sapiens (Human) (see 5 papers)
31% identity, 63% coverage: 11:265/403 of query aligns to 43:298/426 of P26440
- 165:174 (vs. 136:145, 70% identical) binding
- S174 (= S145) binding
- WIT 198:200 (≠ WTS 169:171) binding
- SR 222:223 (≠ QG 191:192) binding
- G250 (vs. gap) to A: in IVA; uncertain significance
- Y277 (≠ T244) binding
- DLER 284:287 (≠ QHER 251:254) binding
- E286 (= E253) active site, Proton acceptor; mutation to D: Residual isovaleryl-CoA dehydrogenase activity.; mutation to G: Loss of isovaleryl-CoA dehydrogenase activity. Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 407-E.; mutation to Q: Loss of isovaleryl-CoA dehydrogenase activity.
- A291 (≠ S258) to V: in IVA; uncertain significance; dbSNP:rs886042098
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 312 binding
- 323 binding
- 379 I → T: in IVA; uncertain significance
- 380:384 binding
- 398 R → Q: in IVA; uncertain significance; dbSNP:rs1477527791
- 403 Y → N: in IVA; uncertain significance
- 407 A→E: Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 286-D.
- 407:408 binding
- 409:411 binding
8sgrA Isovaleryl-CoA dehydrogenase, mitochondrial (see paper)
31% identity, 63% coverage: 11:265/403 of query aligns to 10:265/393 of 8sgrA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 279, 282, 286, 289, 347, 348, 351, 369, 375, 376, 382
1ivhA Structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity (see paper)
31% identity, 63% coverage: 11:265/403 of query aligns to 6:261/387 of 1ivhA
- active site: M130 (≠ Y138), S131 (= S139), E249 (= E253)
- binding coenzyme a persulfide: S137 (= S145), S185 (≠ Q191), R186 (≠ G192), V239 (≠ W243), Y240 (≠ T244), M243 (≠ K247), E249 (= E253), R250 (= R254)
- binding flavin-adenine dinucleotide: L128 (≠ Q136), M130 (≠ Y138), S131 (= S139), G136 (= G144), S137 (= S145), W161 (= W169), T163 (≠ S171)
Sites not aligning to the query:
- active site: 370, 382
- binding coenzyme a persulfide: 369, 370, 371, 375
- binding flavin-adenine dinucleotide: 275, 278, 285, 288, 343, 344, 347, 372, 374
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
29% identity, 84% coverage: 59:398/403 of query aligns to 45:378/379 of 1ukwB
- active site: L124 (≠ Y138), S125 (= S139), T241 (≠ E253), E362 (≠ G382), R374 (≠ K394)
- binding cobalt (ii) ion: D145 (= D159), H146 (= H160)
- binding flavin-adenine dinucleotide: F122 (≠ Q136), L124 (≠ Y138), S125 (= S139), G130 (= G144), S131 (= S145), W155 (= W169), S157 (= S171), K200 (≠ Q212), L357 (≠ A377), Y361 (= Y381), E362 (≠ G382), T364 (≠ S384), E366 (= E386), L370 (≠ N390)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
29% identity, 84% coverage: 59:398/403 of query aligns to 45:378/379 of 1ukwA
- active site: L124 (≠ Y138), S125 (= S139), T241 (≠ E253), E362 (≠ G382), R374 (≠ K394)
- binding flavin-adenine dinucleotide: F122 (≠ Q136), L124 (≠ Y138), S125 (= S139), G130 (= G144), S131 (= S145), W155 (= W169), S157 (= S171), L357 (≠ A377), Y361 (= Y381), E362 (≠ G382), T364 (≠ S384), E366 (= E386), L370 (≠ N390)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
28% identity, 83% coverage: 64:397/403 of query aligns to 50:377/378 of 5ol2F
- active site: L124 (≠ Y138), T125 (≠ S139), G241 (= G260), G374 (≠ K394)
- binding coenzyme a persulfide: L238 (= L257), R242 (≠ G261), E362 (≠ G382), G363 (= G383)
- binding flavin-adenine dinucleotide: F122 (≠ Q136), L124 (≠ Y138), T125 (≠ S139), P127 (= P141), T131 (≠ S145), F155 (≠ W169), I156 (≠ T170), T157 (≠ S171), E198 (≠ P210), R267 (= R286), F270 (≠ L292), L274 (≠ I296), F277 (≠ W299), Q335 (= Q349), L336 (≠ G350), G338 (≠ E352), G339 (= G353), Y361 (= Y381), T364 (≠ S384), E366 (= E386)
Sites not aligning to the query:
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
32% identity, 53% coverage: 45:258/403 of query aligns to 26:247/380 of 4l1fA
- active site: L125 (≠ Y138), T126 (≠ S139), G242 (≠ E253)
- binding coenzyme a persulfide: T132 (≠ S145), H179 (≠ G192), F232 (≠ W243), M236 (≠ K247), E237 (≠ R248), L239 (= L250), D240 (≠ Q251), R243 (= R254)
- binding flavin-adenine dinucleotide: F123 (≠ Q136), L125 (≠ Y138), T126 (≠ S139), G131 (= G144), T132 (≠ S145), F156 (≠ W169), I157 (≠ T170), T158 (≠ S171)
Sites not aligning to the query:
- active site: 363, 375
- binding coenzyme a persulfide: 362, 363, 364, 375
- binding flavin-adenine dinucleotide: 268, 270, 271, 275, 278, 281, 336, 337, 340, 358, 362, 365, 367
- binding 1,3-propandiol: 5, 10
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
28% identity, 88% coverage: 46:398/403 of query aligns to 31:374/374 of 5lnxD
- active site: L122 (≠ Y138), T123 (≠ S139), G239 (≠ E253), E358 (≠ G382), K370 (= K394)
- binding flavin-adenine dinucleotide: L122 (≠ Y138), T123 (≠ S139), G128 (= G144), S129 (= S145), F153 (≠ W169), T155 (≠ S171), R265 (≠ Y278), Q267 (≠ G280), F268 (vs. gap), I272 (vs. gap), N275 (≠ A283), I278 (vs. gap), Q331 (= Q349), I332 (≠ G350), G335 (= G353), Y357 (= Y381), T360 (≠ S384), E362 (= E386)
8sgsA Short-chain specific acyl-CoA dehydrogenase, mitochondrial (see paper)
27% identity, 86% coverage: 53:397/403 of query aligns to 38:377/381 of 8sgsA
- binding coenzyme a: S131 (= S145), A133 (≠ L147), N177 (≠ Q191), F231 (≠ W243), M235 (≠ K247), L238 (= L250), I312 (= I329), E362 (≠ G382), G363 (= G383)
- binding flavin-adenine dinucleotide: F122 (≠ Q136), L124 (≠ Y138), S125 (= S139), G130 (= G144), S131 (= S145), W155 (= W169), T157 (≠ S171), R267 (= R286), F270 (vs. gap), L274 (≠ D291), L277 (≠ A294), Q335 (≠ E352), I336 (≠ G353), G338 (= G355), G339 (= G358), I357 (≠ A377), I360 (= I380), Y361 (= Y381), T364 (≠ S384), E366 (= E386)
Query Sequence
>Ga0059261_0861 FitnessBrowser__Korea:Ga0059261_0861
MATLAEPATGTGLDQFRTEVREWLAANFPASLKGKDNTMSAVEGPTEETPDQAAWRKAMG
EKGWGVPTWPREYGGGGLSRAEAKVLADEMAKAGAWNPIGGMGVMMFGPTLLEYGNEAQK
REHIPAIAKGEVRWCQGYSEPNAGSDLANLQCFAEDKGDHYLVNGQKTWTSGGQWADKCF
CIVRTDKTQKQGGITFLLIDMDTPGVEVKPIQMISGMSPFCETFFTNVKVPKENRVGEEG
QGWTIGKRLLQHERTNLSGGGSRLMPSGPSLADIAKNYVGADAEGRVADPDLRARIAKWE
MDWRAFLLTAMRVQAESKAAGGVSEVSSILKTVGTKLGQERAELLIEIQGHEGLGWEGEG
FSEAQLKGTRAWLFGKATTIYGGSTEIQNNIIAKRILGMLDHQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory